Lus10007213 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17020 110 / 3e-29 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT4G25310 108 / 2e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G78550 105 / 3e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17010 101 / 6e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25300 99 / 1e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G21420 95 / 2e-23 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G05600 88 / 8e-21 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G24530 87 / 1e-20 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10500 82 / 8e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25420 81 / 3e-18 AT2301, GA5, ATGA20OX1 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015252 131 / 3e-37 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1)
Lus10011979 118 / 3e-32 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Lus10011980 118 / 4e-32 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Lus10025369 118 / 5e-32 AT1G17010 187 / 4e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011981 117 / 9e-32 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
Lus10042493 111 / 5e-31 AT1G17020 242 / 4e-80 senescence-related gene 1 (.1)
Lus10011985 115 / 7e-31 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1)
Lus10026173 113 / 3e-30 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1)
Lus10022292 107 / 5e-28 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G025900 125 / 5e-35 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.001G382400 118 / 2e-32 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1)
Potri.001G355100 112 / 8e-30 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1)
Potri.001G381700 104 / 6e-27 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Potri.001G355200 93 / 1e-22 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1)
Potri.010G023600 91 / 5e-22 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101200 90 / 1e-21 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101100 88 / 5e-21 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.016G117100 86 / 4e-20 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G188000 86 / 4e-20 AT5G05600 511 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10007213 pacid=23167604 polypeptide=Lus10007213 locus=Lus10007213.g ID=Lus10007213.BGIv1.0 annot-version=v1.0
ATGGACTGGTGCATGGAAACCCTGGATGAATACTCAACAACACTGTATAGTTTGACACTGACGATTCTCGATGTTATAGCAAAATCTTTGGGAGTCCATC
AAAATGAGATGAGGGAGTTGTTCACCGGGGGTTGGCAGAACATAAGAGTCAACTATTATCCACCATGTCCACAACCAGACCTGGCAATGGGGTTCAACCC
TCATTCTGATCCTGTTGGTCTTACTGTCCTCTTCCAACTCACTACTGATACGCATGGCCTAGAAATTAAAAAAGACGGTCGATGGGCTTCAGTTGCTCCT
CTTCCTAATGCATTCATCATCAATGTTTGTGACATCATCGAGGGGGAAGTGCTATGCAGCAGGTGGTTTTCATCTAGACCACTTACTGGAGTTGCCGAGA
CAGGTGATCTTGACGATGCGAGCACAACCATCTGCTACTTGATTGCGTTGTTGGGCTCCACTGTTTTTGCGGACCGCAGTCAGACTCGTGTCTGTATTGG
GGATCTTGAGGGATTGTGA
AA sequence
>Lus10007213 pacid=23167604 polypeptide=Lus10007213 locus=Lus10007213.g ID=Lus10007213.BGIv1.0 annot-version=v1.0
MDWCMETLDEYSTTLYSLTLTILDVIAKSLGVHQNEMRELFTGGWQNIRVNYYPPCPQPDLAMGFNPHSDPVGLTVLFQLTTDTHGLEIKKDGRWASVAP
LPNAFIINVCDIIEGEVLCSRWFSSRPLTGVAETGDLDDASTTICYLIALLGSTVFADRSQTRVCIGDLEGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10007213 0 1

Lus10007213 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.