Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36720 195 / 6e-64 HVA22K HVA22-like protein K (.1) AT1G75700 69 / 7e-15 HVA22G HVA22-like protein G (.1) AT5G42560 66 / 6e-13 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT1G19950 64 / 1e-12 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT5G62490 62 / 2e-12 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT1G69700 54 / 2e-09 ATHVA22C HVA22 homologue C (.1) AT2G36020 54 / 8e-09 HVA22J HVA22-like protein J (.1) AT5G50720 51 / 8e-09 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT4G24960 51 / 2e-08 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT2G42820 50 / 7e-08 HVA22F HVA22-like protein F (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010093 [exp] 315 / 1e-111 AT4G36720 202 / 2e-66 HVA22-like protein K (.1) Lus10034519 [exp] 67 / 1e-13 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10033152 [exp] 67 / 2e-13 AT5G42560 328 / 7e-113 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10024332 [exp] 65 / 8e-13 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10016974 [exp] 64 / 1e-12 AT2G36020 210 / 2e-68 HVA22-like protein J (.1) Lus10021299 [exp] 62 / 6e-12 AT2G36020 206 / 6e-67 HVA22-like protein J (.1) Lus10004215 [exp] 61 / 7e-12 AT2G36020 196 / 6e-64 HVA22-like protein J (.1) Lus10023605 [exp] 61 / 2e-11 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10024234 [exp] 61 / 2e-11 AT1G74520 244 / 5e-83 HVA22 homologue A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G113400 [exp] 227 / 8e-77 AT4G36720 241 / 1e-81 HVA22-like protein K (.1) Potri.007G029300 [exp] 196 / 3e-64 AT4G36720 252 / 2e-85 HVA22-like protein K (.1) Potri.005G237900 [exp] 67 / 2e-13 AT5G42560 274 / 1e-91 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.016G072600 [exp] 63 / 1e-12 AT2G36020 210 / 9e-69 HVA22-like protein J (.1) Potri.002G023500 [exp] 63 / 4e-12 AT5G42560 296 / 2e-100 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.006G205300 [exp] 61 / 1e-11 AT2G36020 228 / 1e-74 HVA22-like protein J (.1) Potri.004G166800 [exp] 61 / 2e-11 AT1G75700 234 / 3e-78 HVA22-like protein G (.1) Potri.012G069300 [exp] 54 / 2e-09 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.015G062800 [exp] 52 / 1e-08 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.014G148600 [exp] 50 / 4e-08 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [flax] [poplar] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Lus10007215 pacid=23167582 polypeptide=Lus10007215 locus=Lus10007215.g ID=Lus10007215.BGIv1.0 annot-version=v1.0 ATGGCGTTCCCAGCTGAGGTTGGACTGCAGTTGCTTCTTTATCCACTCAATTCCAGTGTTGTTCTCAGAACAGCATGCTGTTCTGTAGGGATTGCTTTGC CTGTTTACACAACATTCAAGGTGATTGAAAGGAAAGACCCAGATGAGCAAAGGAAATGTCTTGTTTACTGGGCAGCTTTTGGAGCTTTTAGTGTTGCAGA AGTGTTTACAGATAAGATCATTTCTTGGTTTCCAATGTACTATCATGCGAAGTTTGCGTTTCTCATTTGGCTGCAGCTTCCATCTATGAATGGAACCGGG GCTACAATTTTCTATTCAAAGTATCTACGTCCTTTCCTACTCAGGCATCAAGTCAGGCTTGACAACATCACAGAAATGGCAAATGGTCTGATGGCTAAAT TTATTCTTGCACACGAATCAGAATTCCGACTTGCGAAAGTGATTTTCATGAAGACTCTGGCATCAGGTATGGGCTTGAATCCCTTGCATTTCTGCTCACA TTTATCAAACTTGTGA
AA sequence Show only first row Show all	>Lus10007215 pacid=23167582 polypeptide=Lus10007215 locus=Lus10007215.g ID=Lus10007215.BGIv1.0 annot-version=v1.0 MAFPAEVGLQLLLYPLNSSVVLRTACCSVGIALPVYTTFKVIERKDPDEQRKCLVYWAAFGAFSVAEVFTDKIISWFPMYYHAKFAFLIWLQLPSMNGTG ATIFYSKYLRPFLLRHQVRLDNITEMANGLMAKFILAHESEFRLAKVIFMKTLASGMGLNPLHFCSHLSNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36720		HVA22K	HVA22-like protein K (.1)		Lus10007215 [exp]	0	1
AT2G39170			unknown protein		Lus10017465 [exp]	2.6	0.8252
AT2G44680		CKB4	casein kinase II beta subunit...		Lus10028159 [exp]	3.7	0.8474
AT1G50370		AtFYPP1	flower- specific, phytochrome-...		Lus10041015 [exp]	4.6	0.8467
AT5G50840			unknown protein		Lus10040383 [exp]	5.6	0.8530
AT1G02330			unknown protein		Lus10042403 [exp]	7.3	0.8068
AT4G02580			NADH-ubiquinone oxidoreductase...		Lus10002721 [exp]	8.0	0.8222
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10013548 [exp]	8.7	0.8110
AT3G18165		MOS4	modifier of snc1,4 (.1)		Lus10041997 [exp]	11.5	0.8159
AT1G55320		AAE18	acyl-activating enzyme 18 (.1....		Lus10012931 [exp]	13.2	0.8389
AT1G51740		ATSYP81, SYP81,...	ORTHOLOG OF YEAST UFE1 \(UNKNO...		Lus10040237 [exp]	13.4	0.8187

Compare expression of checked genes

Lus10007215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.