Plant FIBer expression Database

Lus10007218 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G39705 43 / 5e-07 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
AT3G55515 36 / 0.0002 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024323
[exp]
118 / 5e-37 AT2G39705 46 / 9e-10 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Lus10002705
[exp]
51 / 4e-10 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Lus10023399
[exp]
0 / 1 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G057800
[exp]
56 / 5e-12 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Potri.010G201700
[exp]
54 / 1e-11 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08137 DVL DVL family
Representative CDS sequence
>Lus10007218 pacid=23167601 polypeptide=Lus10007218 locus=Lus10007218.g ID=Lus10007218.BGIv1.0 annot-version=v1.0
ATGAAGAATTCTTCCCAGCGGAGGTGCTCGTTCTCGAGGAAATACGCCAGGCTTGTCAAGGAACAGCGCGCCAGGTTCTACATCATCGCAGGTGCGTCAC
CATGCTCATCTGCTGGCGCGATTACAGCGATGCTCAACTCCCAGGAAGTTCTTTCAAAACGACGACCGCCGCTGGAGGCGAGGAAAGATTTCTGA
AA sequence
>Lus10007218 pacid=23167601 polypeptide=Lus10007218 locus=Lus10007218.g ID=Lus10007218.BGIv1.0 annot-version=v1.0
MKNSSQRRCSFSRKYARLVKEQRARFYIIAGASPCSSAGAITAMLNSQEVLSKRRPPLEARKDF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G39705 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 ... Lus10007218
[exp]
0 1
AT1G24190 SNL3, AtSin3 ARABIDOPSIS THALIANA SIN3 HOMO... Lus10022887
[exp]
24.4 0.6258
AT1G15060 Uncharacterised conserved prot... Lus10000099
[exp]
25.6 0.6338
AT1G61065 Protein of unknown function (D... Lus10011208
[exp]
28.2 0.6578
AT5G14890 NHL domain-containing protein ... Lus10001933
[exp]
49.5 0.6020
AT5G51280 DEAD-box protein abstrakt, put... Lus10008856
[exp]
74.2 0.5961
AT4G02340 alpha/beta-Hydrolases superfam... Lus10011435
[exp]
75.9 0.6048
AT2G30690 Protein of unknown function, D... Lus10014743
[exp]
85.5 0.6056
AT3G14090 ATEXO70D3 exocyst subunit exo70 family p... Lus10001113
[exp]
145.9 0.5706
AT2G27080 Late embryogenesis abundant (L... Lus10025548
[exp]
201.9 0.5396
AT5G63100 S-adenosyl-L-methionine-depend... Lus10037637
[exp]
205.7 0.5283

Lus10007218 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.