Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G28740 152 / 5e-44 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT4G37370 147 / 1e-42 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT2G23220 148 / 2e-42 CYP81D6 "cytochrome P450, family 81, subfamily D, polypeptide 6", cytochrome P450, family 81, subfamily D, polypeptide 6 (.1) AT4G37340 147 / 2e-42 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT2G23190 147 / 5e-42 CYP81D7 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) AT1G66540 142 / 5e-42 Cytochrome P450 superfamily protein (.1.2) AT4G37320 144 / 2e-41 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT4G37330 143 / 6e-41 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT5G36220 138 / 5e-39 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT4G37360 137 / 1e-38 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011958 [exp] 177 / 9e-54 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10027614 [exp] 174 / 8e-53 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10020437 [exp] 171 / 3e-51 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018717 [exp] 136 / 3e-38 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024819 [exp] 135 / 6e-38 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10041643 [exp] 132 / 2e-36 AT4G37320 433 / 6e-148 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024816 [exp] 130 / 5e-36 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024078 [exp] 130 / 1e-35 AT4G37320 437 / 3e-149 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024818 [exp] 128 / 4e-35 AT4G37320 480 / 2e-166 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G006000 [exp] 150 / 2e-43 AT4G37370 526 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.008G205200 [exp] 139 / 3e-39 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021800 [exp] 138 / 5e-39 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Potri.002G121300 [exp] 135 / 6e-39 AT4G37370 308 / 2e-101 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.007G050000 [exp] 136 / 2e-38 AT4G37370 509 / 3e-178 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.005G143800 [exp] 135 / 8e-38 AT4G37370 539 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G007900 [exp] 133 / 3e-37 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G007000 [exp] 133 / 5e-37 AT4G37370 525 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.007G049900 [exp] 128 / 3e-35 AT4G37370 490 / 1e-170 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.005G144000 [exp] 127 / 9e-35 AT5G36220 496 / 6e-173 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10007221 pacid=23167591 polypeptide=Lus10007221 locus=Lus10007221.g ID=Lus10007221.BGIv1.0 annot-version=v1.0 ATGAGGATGATTGTCGGGAAGAGATACTACGGGAATGTACAGTTGGCCGAACAAGACCAAGAGGATGCAGCTGAATTTAACGAGGTGGTGAAAGAGGTTA TCGCCCATACCGGAGCTTCCAGTAGTGCAGATTTCTTGCCTATTTTGAATTGGATCGACTGCAGTAAATTTGAGAGGAAATTGGTCAGACTTTCGACGAG GATGGACAAGTTGCTGCAAGACTTGATTGATGAACGTAGAAACAGCGACAATGAAGATTCCAACAGGAACACAATGATTGACAATCTGCTGTCCTTGCAG CAGTCACAGCCAGATTACTACTCCGACCAGATTATTAAAGGGCTTATACAGATTATGTTGCTGGCGGGAACCGACACGGCAGCAGTGACACTAGAATGGG CAATGTCAAGCTTACTAAACCATCCACAAATCCTAAACAAAGCAAGAAAAGAAATCGAAACTCAAATCGGATGGGAAGAGATGAAAAGTCGAAATTCTCT TTAA
AA sequence Show only first row Show all	>Lus10007221 pacid=23167591 polypeptide=Lus10007221 locus=Lus10007221.g ID=Lus10007221.BGIv1.0 annot-version=v1.0 MRMIVGKRYYGNVQLAEQDQEDAAEFNEVVKEVIAHTGASSSADFLPILNWIDCSKFERKLVRLSTRMDKLLQDLIDERRNSDNEDSNRNTMIDNLLSLQ QSQPDYYSDQIIKGLIQIMLLAGTDTAAVTLEWAMSSLLNHPQILNKARKEIETQIGWEEMKSRNSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Lus10007221 [exp]	0	1

Compare expression of checked genes

Lus10007221 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.