Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17870 88 / 9e-24 PSRP6 plastid-specific 50S ribosomal protein 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028238 [exp] 158 / 2e-51 AT5G17870 96 / 7e-27 plastid-specific 50S ribosomal protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G112500 [exp] 108 / 8e-32 AT5G17870 93 / 9e-26 plastid-specific 50S ribosomal protein 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007237 pacid=23182149 polypeptide=Lus10007237 locus=Lus10007237.g ID=Lus10007237.BGIv1.0 annot-version=v1.0 ATGGCGATGTCTTCTATTTTGGGTTCTCCCTTACTCCTTCCGAAATCATCACCCTCAGCACCCACCTTCAAACCCTTCACCGGAGTCACTCAACTGAAGC CAACGACTAGCGGTGGTTGTGGTGGGTTAACGATAGAATGCTCATCGAGGCCGCAGAAGAAGGCGACGGCTCACCATAGGAAGACAAGGCCGAGGAAAAG TCAGCCGTGGGATATTAAGCGGACACCCACCGTTTACCCGCAACTGCCTGAGCTTCCTCCTGACTGGACTCTAGTCTCCGCCGCAGATGTCGGTGATGCT GATGCTGGTGCTGCCGTTGAGACTGCTCTGGCTTCTGCTTCTTAG
AA sequence Show only first row Show all	>Lus10007237 pacid=23182149 polypeptide=Lus10007237 locus=Lus10007237.g ID=Lus10007237.BGIv1.0 annot-version=v1.0 MAMSSILGSPLLLPKSSPSAPTFKPFTGVTQLKPTTSGGCGGLTIECSSRPQKKATAHHRKTRPRKSQPWDIKRTPTVYPQLPELPPDWTLVSAADVGDA DAGAAVETALASAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17870		PSRP6	plastid-specific 50S ribosomal...		Lus10007237 [exp]	0	1
AT5G17870		PSRP6	plastid-specific 50S ribosomal...		Lus10028238 [exp]	1.0	0.9485
AT2G23670		YCF37	homolog of Synechocystis YCF37...		Lus10022478 [exp]	2.0	0.9246
AT1G29910		AB180, LHCB1.2,...	LIGHT HARVESTING CHLOROPHYLL A...		Lus10023321 [exp]	3.0	0.9226
AT2G23670		YCF37	homolog of Synechocystis YCF37...		Lus10016781 [exp]	4.5	0.9205
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Lus10038575 [exp]	6.9	0.9215
AT3G06510		SFR2, ATSFR2	SENSITIVE TO FREEZING 2, Glyco...		Lus10011147 [exp]	7.9	0.9105
AT1G29910		AB180, LHCB1.2,...	LIGHT HARVESTING CHLOROPHYLL A...		Lus10038490 [exp]	8.7	0.8936
AT3G63410		VTE3, APG1, IEP...	VITAMIN E DEFECTIVE 3, INNER E...		Lus10018747 [exp]	10.7	0.9105
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Lus10037875 [exp]	12.0	0.9102
AT3G56940		CRD1, CHL27, AC...	COPPER RESPONSE DEFECT 1, dica...		Lus10035398 [exp]	14.1	0.9084

Compare expression of checked genes

Lus10007237 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.