Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10030 163 / 4e-53 ERG28 homolog of yeast ergosterol28 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028239 [exp] 227 / 1e-78 AT1G10030 165 / 7e-54 homolog of yeast ergosterol28 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G112700 [exp] 169 / 8e-56 AT1G10030 197 / 2e-66 homolog of yeast ergosterol28 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03694 [flax] [poplar] Erg28 Erg28 like protein
Representative CDS sequence Show only first row Show all	>Lus10007238 pacid=23182157 polypeptide=Lus10007238 locus=Lus10007238.g ID=Lus10007238.BGIv1.0 annot-version=v1.0 ATGGAAGCGTTAGGATGGTGGCTAATGCTCGTAGGATCGCTCCGTTTAGCTTCCGTCTGGTTCGGTTTCTTCAACATTCCCAGGCTTAGGTCCGGCGTCT ACGGCAAGTCCCCCGTGACTGCAGTACATGGAAGGACATTTGCAATCTGGACACTGGTGACTTGCACTCTATGCTATACGTGTGCATTCAACCTTGATAA CAAGCCACTTTATTTGGTGACCTTGTTATCATTCATATATGCGCTTCTTCATTTCATGAGTGAAACCCTAATCTATCAGTCGATGAGCATTGCTAACTTG ACAACTGTAAGCTTATTTGCAGGTAAGACTGTTGCCTTTTATCTGCTTTGA
AA sequence Show only first row Show all	>Lus10007238 pacid=23182157 polypeptide=Lus10007238 locus=Lus10007238.g ID=Lus10007238.BGIv1.0 annot-version=v1.0 MEALGWWLMLVGSLRLASVWFGFFNIPRLRSGVYGKSPVTAVHGRTFAIWTLVTCTLCYTCAFNLDNKPLYLVTLLSFIYALLHFMSETLIYQSMSIANL TTVSLFAGKTVAFYLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G10030		ERG28	homolog of yeast ergosterol28 ...		Lus10007238 [exp]	0	1
AT5G44450			methyltransferases (.1)		Lus10042846 [exp]	2.8	0.6453
AT5G01740			Nuclear transport factor 2 (NT...		Lus10001261 [exp]	4.5	0.6618
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10024230 [exp]	17.8	0.6298
AT5G53500			Transducin/WD40 repeat-like su...		Lus10011313 [exp]	19.0	0.5908
AT1G32260			unknown protein		Lus10030982 [exp]	24.0	0.5561
AT5G42250			Zinc-binding alcohol dehydroge...		Lus10005651 [exp]	25.1	0.6235
AT5G36210			alpha/beta-Hydrolases superfam...		Lus10032765 [exp]	26.0	0.5383
AT2G17420		NTR2, ATNTRA, N...	NADPH-DEPENDENT THIOREDOXIN RE...		Lus10019550 [exp]	28.1	0.5515
AT4G18590			Nucleic acid-binding, OB-fold-...		Lus10022705 [exp]	28.4	0.6042
AT3G10520		ATGLB2, ARATHGL...	NON-SYMBIOTIC HAEMOGLOBIN 2, A...		Lus10038655 [exp]	29.4	0.5955

Compare expression of checked genes

Lus10007238 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.