Lus10007244 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007244 pacid=23182166 polypeptide=Lus10007244 locus=Lus10007244.g ID=Lus10007244.BGIv1.0 annot-version=v1.0
ATGGATTGCCAAAAGGTAGGTGGGAGCTCCGGCGGAAGTGGTGGCGAGGCCGGCCGCCGCCCGGGAGGGGGCTTGATTCCGGCAGAGAGAGCCAATCCCC
CCGCTGAAAGCGCGCACGGTCTCTCTACTCTCTACTGTTCTTTCAAGATTCAACCAATTTTCACGGGCGAACCCTAA
AA sequence
>Lus10007244 pacid=23182166 polypeptide=Lus10007244 locus=Lus10007244.g ID=Lus10007244.BGIv1.0 annot-version=v1.0
MDCQKVGGSSGGSGGEAGRRPGGGLIPAERANPPAESAHGLSTLYCSFKIQPIFTGEP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007244 0 1
Lus10024103 1.7 0.8590
AT2G40540 ATKUP2, ATKT2, ... potassium transporter 2 (.1.2) Lus10018270 3.0 0.8107
AT5G06900 CYP93D1 "cytochrome P450, family 93, s... Lus10035502 4.9 0.7967
AT4G21310 Protein of unknown function (D... Lus10018386 5.7 0.8494
Lus10029087 6.0 0.8567
AT3G58670 Protein of unknown function (D... Lus10020711 6.2 0.7819
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10016495 7.5 0.8394
Lus10024490 7.7 0.8272
AT3G49730 Tetratricopeptide repeat (TPR)... Lus10027318 8.9 0.7360
AT3G51150 ATP binding microtubule motor ... Lus10015448 10.2 0.7682

Lus10007244 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.