Lus10007246 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49680 303 / 2e-101 ATBCAT-3 ,BCAT3 branched-chain aminotransferase 3 (.1.2)
AT5G65780 301 / 8e-101 ATBCAT-5 branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5) (.1), branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5) (.2)
AT1G10070 257 / 5e-84 ATBCAT-2 branched-chain amino acid transaminase 2 (.1.2.3)
AT1G50110 238 / 1e-76 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1)
AT1G50090 237 / 3e-76 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1)
AT1G10060 216 / 3e-68 ATBCAT-1 branched-chain amino acid transaminase 1 (.1.2.3)
AT3G19710 211 / 2e-66 BCAT4 branched-chain aminotransferase4 (.1)
AT5G27410 67 / 2e-12 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1.2)
AT3G05190 59 / 9e-10 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011567 289 / 5e-96 AT3G49680 615 / 0.0 branched-chain aminotransferase 3 (.1.2)
Lus10028246 293 / 1e-95 AT1G10070 498 / 3e-174 branched-chain amino acid transaminase 2 (.1.2.3)
Lus10019258 286 / 7e-95 AT3G49680 613 / 0.0 branched-chain aminotransferase 3 (.1.2)
Lus10011604 277 / 1e-91 AT3G49680 568 / 0.0 branched-chain aminotransferase 3 (.1.2)
Lus10032806 239 / 1e-77 AT1G10070 484 / 1e-172 branched-chain amino acid transaminase 2 (.1.2.3)
Lus10007247 206 / 1e-63 AT1G10070 517 / 0.0 branched-chain amino acid transaminase 2 (.1.2.3)
Lus10028247 199 / 3e-62 AT1G10070 469 / 6e-168 branched-chain amino acid transaminase 2 (.1.2.3)
Lus10035342 58 / 3e-09 AT5G27410 910 / 0.0 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1.2)
Lus10029984 45 / 5e-05 AT5G27410 869 / 0.0 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G008000 307 / 3e-103 AT5G65780 578 / 0.0 branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5) (.1), branched-chain amino acid aminotransferase 5 / branched-chain amino acid transaminase 5 (BCAT5) (.2)
Potri.002G113600 264 / 1e-86 AT1G10070 555 / 0.0 branched-chain amino acid transaminase 2 (.1.2.3)
Potri.009G082600 253 / 3e-82 AT1G50110 448 / 4e-158 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1)
Potri.009G082700 226 / 9e-72 AT1G10070 446 / 2e-156 branched-chain amino acid transaminase 2 (.1.2.3)
Potri.005G039100 57 / 4e-09 AT5G27410 882 / 0.0 D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01063 Aminotran_4 Amino-transferase class IV
Representative CDS sequence
>Lus10007246 pacid=23182147 polypeptide=Lus10007246 locus=Lus10007246.g ID=Lus10007246.BGIv1.0 annot-version=v1.0
ATGACTTTTACAAACTGGGACTGCCTCGGATTCGATCCCTTACCCACAGACTATATGTATGTGATGAAGTGTTCTGGAGGTGATACATTTTCAGATGGGC
AGTTGCTACCATTTGGGAAGATTGCATTGAATCCTTTCTCTTCTGTCTTGAATTATGGACAGGGCATAATTGAAGGGCTGAAAGCACACAAGAAAGCAAT
TCCACCTCCAAATAAAGGCTTTCTGCACATCCGTCCGTTGCTTCTGGGGACTAGCTCTTCTCTTAGTCTAACTCCCTCTTCTGAGTTTATGTTTGTTACA
TATGTTACCCCCGTTGGGAGCTATTTTGAGAGTAGTTTGGAGCCAATTAACCTGTTGATTGATGATGAAACTCATCGAGCCGTTCCAGGTGGAGTTGGAT
GTATAAAGGCTATAGGGAACTATGCTGGGATTTTGAAAGCTCATGGTAGTGCCAAGAGAAATGGTTTCAATGATGTTTTATACGTTGATTCAGTCTATAA
CAGATACTTGGAAGAAGTTTCCACTGCTAATATCTTTGTTGTAAAGGATGATAAAATATGCACACCTAAGCTAGGAGGGACGATATTGCCTGGGATTACT
CGGTCGAGTACGATCGACCTTGCTAGGATCCTGGATTTTCAAGTAACGGAGCAGCTTGTATCAATTGAGGAATTACTTAATGCTGATGAAGTATTCTGCA
CAGGACATGCTATTGGGTTATTGCCTGTGGGTAGTATAACTTACCATGATAAAAGGGTCTGCTACGGAGATGGTGGTCCAGGCAAGGTAACCCAACGGCT
CTCTTCTCATCTAGCAAACATACAGATGGGACTTGCAGAAGATACAATGGGTTGGACTATTGTACTGAAGTAA
AA sequence
>Lus10007246 pacid=23182147 polypeptide=Lus10007246 locus=Lus10007246.g ID=Lus10007246.BGIv1.0 annot-version=v1.0
MTFTNWDCLGFDPLPTDYMYVMKCSGGDTFSDGQLLPFGKIALNPFSSVLNYGQGIIEGLKAHKKAIPPPNKGFLHIRPLLLGTSSSLSLTPSSEFMFVT
YVTPVGSYFESSLEPINLLIDDETHRAVPGGVGCIKAIGNYAGILKAHGSAKRNGFNDVLYVDSVYNRYLEEVSTANIFVVKDDKICTPKLGGTILPGIT
RSSTIDLARILDFQVTEQLVSIEELLNADEVFCTGHAIGLLPVGSITYHDKRVCYGDGGPGKVTQRLSSHLANIQMGLAEDTMGWTIVLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49680 ATBCAT-3 ,BCAT3 branched-chain aminotransferas... Lus10007246 0 1
Lus10023136 1.4 0.9712
Lus10004849 2.4 0.9544
Lus10011452 3.0 0.9430
AT5G16600 MYB ATMYB43 myb domain protein 43 (.1) Lus10010974 3.5 0.9366
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10009003 7.7 0.9208
AT1G49740 PLC-like phosphodiesterases su... Lus10041594 10.4 0.8993
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10015094 12.6 0.7540
AT5G47180 Plant VAMP (vesicle-associated... Lus10000591 13.0 0.8559
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10012866 14.3 0.8249
Lus10011497 21.4 0.9195

Lus10007246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.