Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G28540 101 / 2e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT3G28510 97 / 8e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28600 95 / 5e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28520 94 / 8e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28580 93 / 2e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28610 92 / 4e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28570 84 / 4e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G40000 81 / 4e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G40010 77 / 1e-17 ASD, AATP1 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) AT3G50940 71 / 1e-15 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015354 [exp] 136 / 5e-39 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10015349 [exp] 111 / 7e-30 AT5G40010 536 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10005256 [exp] 102 / 1e-26 AT5G40010 501 / 4e-172 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10030667 [exp] 100 / 8e-26 AT5G40010 501 / 2e-174 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10014498 [exp] 97 / 6e-25 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10014496 [exp] 89 / 9e-22 AT5G40010 577 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10042166 [exp] 84 / 4e-20 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10004258 [exp] 84 / 4e-20 AT3G28580 507 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10014497 [exp] 82 / 2e-19 AT3G28580 463 / 7e-160 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G091250 [exp] 112 / 3e-33 AT3G28540 110 / 2e-29 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.004G012601 [exp] 111 / 6e-30 AT5G40010 566 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012700 [exp] 111 / 6e-30 AT5G40010 566 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G091500 [exp] 109 / 3e-29 AT5G40010 582 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012500 [exp] 107 / 8e-29 AT5G40010 556 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.019G020700 [exp] 97 / 1e-24 AT5G40010 531 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.013G047900 [exp] 97 / 1e-24 AT5G40010 537 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.013G047950 [exp] 96 / 2e-24 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.019G020800 [exp] 94 / 7e-24 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.015G067400 [exp] 94 / 1e-23 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007270 pacid=23165712 polypeptide=Lus10007270 locus=Lus10007270.g ID=Lus10007270.BGIv1.0 annot-version=v1.0 ATGGACATGCACGTTGAAATGTCCTACTGTTGCTTCGAGGCTTTCAAGCTACTGGTCAGAAATTACCTGGATATTGAAGAGCATGAGCTGTTTGCAAGGA TTGAGGAACTGATTGGGGAAACCAAGATGACACCCGCTGATGTTGCTGAGAATTTGATGCCCAAATTGGATGAAGAAGATAAGGACATGTGTTTGAGGAA CTTGGTTGAAGCACTTGAAGCTGCAAAGGAGGATCAAGCTAAGGAGGAGAAGGCGAAAGAAGAAGCAAAGCGAAAGGAGGAGAAGAAACTAGCTAATAAC GTTAATGTAGAAGAAGAAGGATGA
AA sequence Show only first row Show all	>Lus10007270 pacid=23165712 polypeptide=Lus10007270 locus=Lus10007270.g ID=Lus10007270.BGIv1.0 annot-version=v1.0 MDMHVEMSYCCFEAFKLLVRNYLDIEEHELFARIEELIGETKMTPADVAENLMPKLDEEDKDMCLRNLVEALEAAKEDQAKEEKAKEEAKRKEEKKLANN VNVEEEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G28540			P-loop containing nucleoside t...		Lus10007270 [exp]	0	1
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10020330 [exp]	1.4	0.9852
					Lus10039496 [exp]	2.0	0.9854
AT2G24960			unknown protein		Lus10042421 [exp]	3.5	0.9789
AT5G05340			Peroxidase superfamily protein...		Lus10030149 [exp]	3.5	0.9752
					Lus10009699 [exp]	3.7	0.9656
					Lus10015488 [exp]	4.4	0.9338
AT2G24600			Ankyrin repeat family protein ...		Lus10024845 [exp]	4.9	0.9293
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	6.3	0.9726
					Lus10018837 [exp]	6.9	0.9682
AT4G04350		EMB2369	EMBRYO DEFECTIVE 2369, tRNA sy...		Lus10020041 [exp]	7.2	0.9211

Compare expression of checked genes

Lus10007270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.