Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51590 67 / 2e-15 LTP12 lipid transfer protein 12 (.1) AT5G59320 67 / 2e-15 LTP3 lipid transfer protein 3 (.1) AT5G59310 66 / 5e-15 LTP4 lipid transfer protein 4 (.1) AT4G33355 65 / 1e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G08770 62 / 1e-13 LTP6 lipid transfer protein 6 (.1.2) AT2G38530 61 / 4e-13 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G01870 60 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 58 / 8e-12 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51600 58 / 8e-12 LTP5 lipid transfer protein 5 (.1) AT2G38540 57 / 2e-11 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029226 [exp] 149 / 8e-48 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10015278 [exp] 90 / 2e-24 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10015279 [exp] 84 / 9e-22 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10014167 [exp] 80 / 3e-20 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10022745 [exp] 79 / 5e-20 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025234 [exp] 74 / 6e-18 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10026418 [exp] 69 / 5e-16 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025230 [exp] 69 / 1e-15 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10025148 [exp] 67 / 3e-15 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 74 / 5e-18 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 72 / 3e-17 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 70 / 1e-16 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 68 / 1e-15 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 63 / 9e-14 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.016G135500 [exp] 61 / 5e-13 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G135700 [exp] 59 / 3e-12 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.014G046500 [exp] 58 / 7e-12 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G108100 [exp] 52 / 2e-09 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232700 [exp] 51 / 2e-09 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10007280 pacid=23142488 polypeptide=Lus10007280 locus=Lus10007280.g ID=Lus10007280.BGIv1.0 annot-version=v1.0 ATGGCCGCCGCAAACTATAAACTGCAGGTTGCTTGCGTGGCGGCGGCGCTCATGGCGGCGATGTTGGTGTCGAGTTCGCACGGCGCGGTGACTTGCGGCC AAGTCACGTCGACCGTGGCTCCGTGCTTCGGCTACATCACGGGGAGTGGGCCACTGGTTCCGGGATGTTGCAACGGTGTCAGATCCCTTAACAACGCCGC CAACAACACGGCCGACAGGAAAGCCACCTGCCGATGCCTGAAGACCCTCGTCGGAGGTGCCCCGGGGATCAATTTGGGTCTCCTCGGTGGGATTCCGGGG AAGTGTCACGTCAATGTTCCCGTCCCACTCAACCCATCCGTTGACTGCAACAAGTGA
AA sequence Show only first row Show all	>Lus10007280 pacid=23142488 polypeptide=Lus10007280 locus=Lus10007280.g ID=Lus10007280.BGIv1.0 annot-version=v1.0 MAAANYKLQVACVAAALMAAMLVSSSHGAVTCGQVTSTVAPCFGYITGSGPLVPGCCNGVRSLNNAANNTADRKATCRCLKTLVGGAPGINLGLLGGIPG KCHVNVPVPLNPSVDCNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10007280 [exp]	0	1
					Lus10008326 [exp]	10.7	0.9911
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10039588 [exp]	15.7	0.9120
AT4G34760			SAUR-like auxin-responsive pro...		Lus10028466 [exp]	16.7	0.9864
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10032263 [exp]	20.6	0.9857
AT3G21720		ICL	isocitrate lyase (.1)		Lus10031552 [exp]	24.0	0.9849
AT2G39370		MAKR4	MEMBRANE-ASSOCIATED KINASE REG...		Lus10003309 [exp]	25.2	0.9659
					Lus10026755 [exp]	26.8	0.9849
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10008511 [exp]	29.4	0.9849
AT4G34215			Domain of unknown function (DU...		Lus10001128 [exp]	30.4	0.9680
					Lus10001326 [exp]	31.7	0.9849

Compare expression of checked genes

Lus10007280 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.