Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73177 50 / 4e-10 APC13, BNS anaphase-promoting complex 13, bonsai (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029234 [exp] 78 / 4e-21 AT1G73177 61 / 2e-14 anaphase-promoting complex 13, bonsai (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G058400 [exp] 61 / 1e-14 AT1G73177 64 / 1e-15 anaphase-promoting complex 13, bonsai (.1) Potri.011G067800 [exp] 61 / 2e-14 AT1G73177 63 / 3e-15 anaphase-promoting complex 13, bonsai (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007286 pacid=23142469 polypeptide=Lus10007286 locus=Lus10007286.g ID=Lus10007286.BGIv1.0 annot-version=v1.0 ATGGCTGAAGTAAGTTTGGGGATTCTCATTGATGTGGTGGACGAGGAGTGGATGACAGATACTTTGCCTAAAGATGATCTTCCCTTGCCTCCTGTCCTGG TTGTTCGCACTGATGACGCTGAAGATTCGAATCATGAGGTTCAACCGGTTGAGCAAGATGCTTGGCATGATCTTGCTTTAGGAAACCAGTGA
AA sequence Show only first row Show all	>Lus10007286 pacid=23142469 polypeptide=Lus10007286 locus=Lus10007286.g ID=Lus10007286.BGIv1.0 annot-version=v1.0 MAEVSLGILIDVVDEEWMTDTLPKDDLPLPPVLVVRTDDAEDSNHEVQPVEQDAWHDLALGNQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10007286 [exp]	0	1
AT5G20090			Uncharacterised protein family...		Lus10025851 [exp]	1.0	0.9354
AT5G03345			unknown protein		Lus10013817 [exp]	2.0	0.9098
AT3G48140			B12D protein (.1)		Lus10042151 [exp]	2.8	0.9318
AT1G64385			unknown protein		Lus10032376 [exp]	4.2	0.9211
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10023582 [exp]	5.3	0.9029
AT3G49420			Got1/Sft2-like vescicle transp...		Lus10026704 [exp]	6.9	0.9080
AT3G48140			B12D protein (.1)		Lus10004241 [exp]	8.4	0.9082
AT1G20575		DPMS1	dolichol phosphate mannose syn...		Lus10030748 [exp]	9.4	0.8923
AT2G30710			Ypt/Rab-GAP domain of gyp1p su...		Lus10019370 [exp]	10.5	0.8702
AT1G28410			unknown protein		Lus10015403 [exp]	11.7	0.8838

Compare expression of checked genes

Lus10007286 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.