Lus10007298 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029247 210 / 2e-70 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G059700 56 / 7e-10 ND /
Potri.011G069800 53 / 4e-09 ND /
PFAM info
Representative CDS sequence
>Lus10007298 pacid=23142490 polypeptide=Lus10007298 locus=Lus10007298.g ID=Lus10007298.BGIv1.0 annot-version=v1.0
ATGGCAGAGTTTCATCACCTAATCGAGAGCCTTGACTCTCTCTGGTTCTTCTCCACCGTCTTCGACGACAACCCATATCCTCCAATCATCCCCACCGCCG
AGAAACCAGCTCACCATCAATTGGAAGAACCGGAGAAAAAACAGAGCAACGACTCTGTTTTTCTGGTAGAGGAAACAATCAAGTTGCCGCCGCCGCCACC
GGCGGAGGCGGCGGAGAAGAAGGAGGAGGAGGTTAGAGTGGAGTTAGTGGTGTTCGTGTCGAAGCCTGAAGCGGCATCGGAGAGGAGGAAGCGGCTGGCG
AGGAGGTTGAGAAGCAAGAACAAGACGATAATATTGCTGGAGCTTGACCTCTGTTTCGACAACTTTTATTATTACAGAGGGTTGTACGGGCTTCCGGTGA
TGAATCAGCAAACGGCGAGGAGGAAGAAGATGCCGCCGTTAAACGACTCGCTGGAGATGAAACGGCAGCTCAAGTCCTGGGCTCACGCCGTCGCCTGCAC
GGTTAAGTGA
AA sequence
>Lus10007298 pacid=23142490 polypeptide=Lus10007298 locus=Lus10007298.g ID=Lus10007298.BGIv1.0 annot-version=v1.0
MAEFHHLIESLDSLWFFSTVFDDNPYPPIIPTAEKPAHHQLEEPEKKQSNDSVFLVEETIKLPPPPPAEAAEKKEEEVRVELVVFVSKPEAASERRKRLA
RRLRSKNKTIILLELDLCFDNFYYYRGLYGLPVMNQQTARRKKMPPLNDSLEMKRQLKSWAHAVACTVK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007298 0 1
AT1G07570 APK1A Protein kinase superfamily pro... Lus10000954 6.2 0.8833
AT4G00330 CRCK2 calmodulin-binding receptor-li... Lus10017787 6.8 0.8460
AT5G11330 FAD/NAD(P)-binding oxidoreduct... Lus10013121 8.5 0.8810
AT1G54730 Major facilitator superfamily ... Lus10029966 8.8 0.8858
AT2G29350 SAG13 senescence-associated gene 13 ... Lus10040737 12.0 0.8347
AT1G10320 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10010687 12.6 0.8490
AT1G01750 ADF11 actin depolymerizing factor 11... Lus10008489 13.4 0.8795
AT3G11210 SGNH hydrolase-type esterase s... Lus10004815 16.4 0.8175
AT1G54730 Major facilitator superfamily ... Lus10035354 18.7 0.8535
AT5G41470 Nuclear transport factor 2 (NT... Lus10024664 20.5 0.8612

Lus10007298 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.