Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29330 179 / 2e-58 ATERD2, AERD2, ERD2 ARABIDOPSIS THALIANA ENDOPLASMIC RETICULUM RETENTION DEFECTIVE 2, ARABIDOPSIS ENDOPLASMIC RETICULUM RETENTION DEFECTIVE 2, ER lumen protein retaining receptor family protein (.1) AT3G25040 156 / 2e-49 ERD2B endoplasmic reticulum retention defective 2B (.1) AT1G19970 66 / 8e-14 ER lumen protein retaining receptor family protein (.1) AT1G75760 66 / 1e-13 ER lumen protein retaining receptor family protein (.1) AT4G38790 64 / 5e-13 ER lumen protein retaining receptor family protein (.1) AT2G21190 62 / 1e-12 ER lumen protein retaining receptor family protein (.1) AT3G25160 62 / 3e-12 ER lumen protein retaining receptor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029263 [exp] 175 / 7e-56 AT1G29330 337 / 7e-118 ARABIDOPSIS THALIANA ENDOPLASMIC RETICULUM RETENTION DEFECTIVE 2, ARABIDOPSIS ENDOPLASMIC RETICULUM RETENTION DEFECTIVE 2, ER lumen protein retaining receptor family protein (.1) Lus10022785 [exp] 153 / 4e-48 AT3G25040 382 / 9e-137 endoplasmic reticulum retention defective 2B (.1) Lus10011846 [exp] 145 / 5e-45 AT3G25040 364 / 7e-130 endoplasmic reticulum retention defective 2B (.1) Lus10043149 [exp] 135 / 7e-41 AT3G25040 332 / 2e-117 endoplasmic reticulum retention defective 2B (.1) Lus10026285 [exp] 66 / 1e-13 AT4G38790 473 / 7e-171 ER lumen protein retaining receptor family protein (.1) Lus10017213 [exp] 65 / 1e-13 AT1G75760 481 / 5e-174 ER lumen protein retaining receptor family protein (.1) Lus10012176 [exp] 65 / 3e-13 AT2G21190 397 / 2e-140 ER lumen protein retaining receptor family protein (.1) Lus10022763 [exp] 64 / 3e-13 AT3G25160 355 / 8e-125 ER lumen protein retaining receptor family protein (.1) Lus10021097 [exp] 64 / 7e-13 AT1G75760 475 / 8e-172 ER lumen protein retaining receptor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G071200 [exp] 169 / 1e-54 AT1G29330 341 / 1e-120 ARABIDOPSIS THALIANA ENDOPLASMIC RETICULUM RETENTION DEFECTIVE 2, ARABIDOPSIS ENDOPLASMIC RETICULUM RETENTION DEFECTIVE 2, ER lumen protein retaining receptor family protein (.1) Potri.017G056000 [exp] 156 / 3e-49 AT3G25040 383 / 3e-137 endoplasmic reticulum retention defective 2B (.1) Potri.001G315800 [exp] 153 / 5e-48 AT3G25040 355 / 3e-126 endoplasmic reticulum retention defective 2B (.1) Potri.004G167400 [exp] 68 / 1e-14 AT4G38790 472 / 1e-170 ER lumen protein retaining receptor family protein (.1) Potri.009G128900 [exp] 68 / 1e-14 AT2G21190 476 / 2e-172 ER lumen protein retaining receptor family protein (.1) Potri.002G022300 [exp] 65 / 1e-13 AT1G75760 464 / 2e-167 ER lumen protein retaining receptor family protein (.1) Potri.002G246700 [exp] 60 / 1e-11 AT3G25160 400 / 5e-142 ER lumen protein retaining receptor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0141 [flax] [poplar] MtN3-like PF00810 [flax] [poplar] ER_lumen_recept ER lumen protein retaining receptor
Representative CDS sequence Show only first row Show all	>Lus10007314 pacid=23142472 polypeptide=Lus10007314 locus=Lus10007314.g ID=Lus10007314.BGIv1.0 annot-version=v1.0 ATGTGTTTTTTTCTAGGGGTTTCTAGGAAGACTCAGGAGCTGTACGCGCTGGTGTTCCTGGCGAGTTTGTTGCAGATCTTCTGGGCCTTCTCAATATATT TGGAAGCAGTGGCTATCCTTCCTCAGTTAGTGTTGCTCCAGAGAAGCGGGAATGTTGATAACTTAACAGGGCAATATGTCATCTTCCTTGGGGCTTACCG TGGACTCTACATCTTGAATTGGATCTATCGTTACGTGACTGAGGCACACTTCGGACGTTGGATAGCTGTTGTCTCTGGTGTCATCCAAACAGCCTTGTAC GCCGACTTCTTCTACTACTACTTCATGAGTTGGAAGAACAAGACGAAGCTCCAGCTGCCAGCTTAA
AA sequence Show only first row Show all	>Lus10007314 pacid=23142472 polypeptide=Lus10007314 locus=Lus10007314.g ID=Lus10007314.BGIv1.0 annot-version=v1.0 MCFFLGVSRKTQELYALVFLASLLQIFWAFSIYLEAVAILPQLVLLQRSGNVDNLTGQYVIFLGAYRGLYILNWIYRYVTEAHFGRWIAVVSGVIQTALY ADFFYYYFMSWKNKTKLQLPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29330		ATERD2, AERD2, ...	ARABIDOPSIS THALIANA ENDOPLASM...		Lus10007314 [exp]	0	1
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10028449 [exp]	6.9	0.7635
AT4G25680			PPPDE putative thiol peptidase...		Lus10027510 [exp]	12.5	0.7632
AT3G63170			Chalcone-flavanone isomerase f...		Lus10022045 [exp]	14.0	0.7155
AT3G07030			Alba DNA/RNA-binding protein (...		Lus10011874 [exp]	14.1	0.7339
AT1G29330		ATERD2, AERD2, ...	ARABIDOPSIS THALIANA ENDOPLASM...		Lus10029263 [exp]	18.6	0.7460
AT1G61150			LisH and RanBPM domains contai...		Lus10018464 [exp]	19.9	0.7424
AT5G06660			Protein of unknown function DU...		Lus10016235 [exp]	20.3	0.7476
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10037071 [exp]	22.6	0.7554
AT1G28120			unknown protein		Lus10030429 [exp]	25.1	0.7381
AT1G14450			NADH dehydrogenase (ubiquinone...		Lus10038124 [exp]	25.9	0.7247

Compare expression of checked genes

Lus10007314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.