Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53400 163 / 2e-53 Ubiquitin domain-containing protein (.1) AT5G45740 150 / 2e-48 Ubiquitin domain-containing protein (.1) AT1G16960 138 / 1e-43 Ubiquitin domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029264 [exp] 198 / 3e-67 AT1G53400 192 / 6e-65 Ubiquitin domain-containing protein (.1) Lus10015233 [exp] 181 / 2e-60 AT1G53400 199 / 1e-67 Ubiquitin domain-containing protein (.1) Lus10005423 [exp] 147 / 4e-47 AT1G53400 165 / 2e-54 Ubiquitin domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G387400 [exp] 162 / 3e-53 AT1G53400 182 / 4e-61 Ubiquitin domain-containing protein (.1) Potri.011G107700 [exp] 154 / 1e-49 AT1G53400 172 / 2e-56 Ubiquitin domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007315 pacid=23142497 polypeptide=Lus10007315 locus=Lus10007315.g ID=Lus10007315.BGIv1.0 annot-version=v1.0 ATGGGTTGCGCCGGATCCTCCTTCGCCACGGCAGACGGAGGCAAGAAGCAGGTGAGGAAGCCAAAGGCATGGAAGCATTCTGAGCCGATCACAAGGGCAC AGCTCGTTAAGATGCGTGACGAGTTCTGGGACACTGCTCCTCACTATGGTGGCCGCAAAGAGATATGGGATGCACTCCGTGCAGCTGCAGAAGCTGATGT GGAACTTGCTCAGGCGATCGTGGACAGTGCAGGCGTCATTCTGCAGAGTGAGGACATGACGATTTGCTACGACGAGAGAGGCGCCAAGTATGAACTCCCA AAGTATGTGTTGAGCGAGCCATCCAATTTGGTCAGTAACGACTGA
AA sequence Show only first row Show all	>Lus10007315 pacid=23142497 polypeptide=Lus10007315 locus=Lus10007315.g ID=Lus10007315.BGIv1.0 annot-version=v1.0 MGCAGSSFATADGGKKQVRKPKAWKHSEPITRAQLVKMRDEFWDTAPHYGGRKEIWDALRAAAEADVELAQAIVDSAGVILQSEDMTICYDERGAKYELP KYVLSEPSNLVSND

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53400			Ubiquitin domain-containing pr...		Lus10007315 [exp]	0	1
AT2G15580			RING/U-box superfamily protein...		Lus10001688 [exp]	3.2	0.8292
AT4G28400			Protein phosphatase 2C family ...		Lus10028094 [exp]	4.8	0.8847
AT2G23810		TET8	tetraspanin8 (.1)		Lus10008891 [exp]	6.0	0.8607
AT1G53400			Ubiquitin domain-containing pr...		Lus10029264 [exp]	6.2	0.8509
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10028639 [exp]	6.7	0.8492
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Lus10018127 [exp]	9.4	0.8508
AT5G41210		GSTU12, GST10, ...	glutathione S-transferase THET...		Lus10008020 [exp]	10.2	0.7643
AT2G23140			RING/U-box superfamily protein...		Lus10011516 [exp]	11.0	0.8277
AT4G02410			Concanavalin A-like lectin pro...		Lus10033777 [exp]	11.8	0.8441
AT1G14860		ATNUDT18	nudix hydrolase homolog 18 (.1...		Lus10003713 [exp]	12.5	0.8228

Compare expression of checked genes

Lus10007315 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.