Lus10007329 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67930 67 / 6e-13 Golgi transport complex protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020753 123 / 9e-35 AT1G67930 87 / 8e-20 Golgi transport complex protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G058300 70 / 8e-14 AT1G67930 1066 / 0.0 Golgi transport complex protein-related (.1)
Potri.005G203900 62 / 4e-11 AT1G67930 1091 / 0.0 Golgi transport complex protein-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0295 Vps51 PF10392 COG5 Golgi transport complex subunit 5
Representative CDS sequence
>Lus10007329 pacid=23166211 polypeptide=Lus10007329 locus=Lus10007329.g ID=Lus10007329.BGIv1.0 annot-version=v1.0
ATGGCGTCGCCGGCGGCGATCCAGAGATCTCAACTCTCTCCATCTTCCTCCCCTCTCCAGAAACTTTCCACTTTCAAGAATCCTACCGTCTCCGCCACCA
CCACTACTGGCGCCGCTTCTCCGCTCGACTCCTTCGCAAATGACCCGATCCTCTCCCCTTTCCTATCCCCTTCTTTCTCTACCACCTCGTTTTCCTCCGC
TGCTCTATCCTCCGGCTCCCCTGCATCGACCGCCGAGCGCCTCCACAACGCAATTCGCCTCCTCGAATCTCAGCTGCGCACCGAAGTCCTTTCCCGCCAT
CCGGAACTCCTTAACCAGCTGTCCTCTCTCAAGCACGCCGAGCACGCGCTCTCCACCGTCCGATCCGCCGTCGCATCGCTCCACTCCTCCGTTCGCCGTT
CGTCGCATCGCTCCAATCCTCCGTTCGCCGTGCGCGATCCGAGCTCTCCGACCCGCACAAGTCCATTCAGTCCAAGACCTCGCAGCTCTCCAATCTCCAT
TCCACCGCCGAGCTATTGCAGCACACGATCCGAGCGCTTCGGCTGTCGAAGAAGCTGCGGGACCTGGCATCCGCGTCGGAGGCGGAGCCGGAAAAGCTCG
ATCTCGCCAAGGCAGCACAGCTGCATTGCGACATTCTGA
AA sequence
>Lus10007329 pacid=23166211 polypeptide=Lus10007329 locus=Lus10007329.g ID=Lus10007329.BGIv1.0 annot-version=v1.0
MASPAAIQRSQLSPSSSPLQKLSTFKNPTVSATTTTGAASPLDSFANDPILSPFLSPSFSTTSFSSAALSSGSPASTAERLHNAIRLLESQLRTEVLSRH
PELLNQLSSLKHAEHALSTVRSAVASLHSSVRRSSHRSNPPFAVRDPSSPTRTSPFSPRPRSSPISIPPPSYCSTRSERFGCRRSCGTWHPRRRRSRKSS
ISPRQHSCIATF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67930 Golgi transport complex protei... Lus10007329 0 1
AT4G34450 coatomer gamma-2 subunit, puta... Lus10026336 2.4 0.9276
AT1G50120 unknown protein Lus10040977 2.8 0.9235
AT1G67930 Golgi transport complex protei... Lus10020753 4.6 0.9030
AT2G21390 Coatomer, alpha subunit (.1) Lus10025780 5.5 0.9207
AT3G05420 ACBP4 acyl-CoA binding protein 4 (.1... Lus10031497 6.6 0.9162
AT1G52360 Coatomer, beta' subunit (.1.2) Lus10011467 9.2 0.9153
AT3G16630 ATKINESIN-13A, ... P-loop containing nucleoside t... Lus10023103 9.4 0.8996
AT5G51430 EYE EMBRYO YELLOW, conserved oligo... Lus10031155 9.8 0.8927
AT5G16300 Vps51/Vps67 family (components... Lus10041337 10.1 0.9052
AT3G05420 ACBP4 acyl-CoA binding protein 4 (.1... Lus10015176 10.4 0.9028

Lus10007329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.