Lus10007338 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29370 68 / 8e-15 Kinase-related protein of unknown function (DUF1296) (.1)
AT1G29350 68 / 9e-15 Kinase-related protein of unknown function (DUF1296) (.1)
AT4G18150 54 / 8e-10 Kinase-related protein of unknown function (DUF1296) (.1)
AT3G13990 51 / 9e-09 Kinase-related protein of unknown function (DUF1296) (.1), Kinase-related protein of unknown function (DUF1296) (.2)
AT3G07660 47 / 1e-07 Kinase-related protein of unknown function (DUF1296) (.1)
AT5G46380 45 / 1e-06 Kinase-related protein of unknown function (DUF1296) (.1)
AT3G13222 37 / 0.001 GIP1 GBF-interacting protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020762 107 / 9e-29 AT1G29370 70 / 4e-12 Kinase-related protein of unknown function (DUF1296) (.1)
Lus10015262 64 / 4e-13 AT1G29370 574 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Lus10004543 63 / 6e-13 AT1G29370 641 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Lus10004604 63 / 8e-13 AT1G29370 644 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Lus10025382 57 / 5e-11 AT1G29350 513 / 4e-171 Kinase-related protein of unknown function (DUF1296) (.1)
Lus10036414 56 / 3e-10 AT3G07660 656 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Lus10041089 55 / 4e-10 AT3G07660 662 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Lus10015640 54 / 8e-10 AT3G13990 561 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1), Kinase-related protein of unknown function (DUF1296) (.2)
Lus10037658 49 / 6e-08 AT3G13990 560 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1), Kinase-related protein of unknown function (DUF1296) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G169900 62 / 1e-12 AT3G07660 491 / 1e-160 Kinase-related protein of unknown function (DUF1296) (.1)
Potri.011G078800 61 / 2e-12 AT1G29350 650 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Potri.003G063300 61 / 3e-12 AT3G13990 619 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1), Kinase-related protein of unknown function (DUF1296) (.2)
Potri.001G353100 59 / 2e-11 AT1G29350 649 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Potri.001G170700 58 / 3e-11 AT3G13990 557 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1), Kinase-related protein of unknown function (DUF1296) (.2)
Potri.002G217000 57 / 6e-11 AT3G07660 600 / 0.0 Kinase-related protein of unknown function (DUF1296) (.1)
Potri.002G059300 51 / 1e-08 AT1G29350 172 / 3e-44 Kinase-related protein of unknown function (DUF1296) (.1)
Potri.011G079800 49 / 7e-08 AT3G07660 125 / 2e-29 Kinase-related protein of unknown function (DUF1296) (.1)
Potri.001G370900 43 / 4e-06 AT3G07660 124 / 3e-29 Kinase-related protein of unknown function (DUF1296) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0214 UBA PF06972 DUF1296 Protein of unknown function (DUF1296)
Representative CDS sequence
>Lus10007338 pacid=23166240 polypeptide=Lus10007338 locus=Lus10007338.g ID=Lus10007338.BGIv1.0 annot-version=v1.0
ATGGGGAGCGAAAGCGGAAGCAAAAGCAGCAATGGCGGCGGCGGCGGTAGCGGCGCTACGACTCTCCAGCAAGTTCCGACGGGGCACAAGAAGATTGTTC
AGAGTTTAAAGGAGGTAGTCAACAACGGCGACTACACCGACGCTGAGATCTACGCTGTTCTCCAGGAATGTGACATGGACCCCAATGAAGCCGTCCAGAA
GCTACTTTCCCAAGGTCTCCGTTTAATTTTTGTCTTCTCTTCGGTTCAGTACGGCACTGCGAGTTGTTGTGTGGCGTAG
AA sequence
>Lus10007338 pacid=23166240 polypeptide=Lus10007338 locus=Lus10007338.g ID=Lus10007338.BGIv1.0 annot-version=v1.0
MGSESGSKSSNGGGGGSGATTLQQVPTGHKKIVQSLKEVVNNGDYTDAEIYAVLQECDMDPNEAVQKLLSQGLRLIFVFSSVQYGTASCCVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G29370 Kinase-related protein of unkn... Lus10007338 0 1
AT1G79730 ELF7 EARLY FLOWERING 7, hydroxyprol... Lus10037558 7.3 0.8481
AT1G01950 AtKINUb, ARK2 Arabidopsis thaliana KINESIN U... Lus10009241 13.3 0.8481
AT1G80490 TPR1 TOPLESS-related 1 (.1.2) Lus10038094 14.1 0.8151
AT4G10070 KH domain-containing protein (... Lus10003519 16.7 0.8260
AT2G20580 RPN1A, AtRPN1a 26S proteasome regulatory subu... Lus10039885 26.5 0.8049
AT4G30935 WRKY ATWRKY32, WRKY3... WRKY DNA-binding protein 32 (.... Lus10022150 28.6 0.7871
AT5G05240 Uncharacterised conserved prot... Lus10029030 29.1 0.8236
AT1G38131 O-fucosyltransferase family pr... Lus10025630 34.1 0.7670
AT5G47010 ATUPF1, UPF1, L... LOW-LEVEL BETA-AMYLASE 1, RNA ... Lus10011054 41.0 0.8110
AT5G04560 DME1, DME DEMETER, HhH-GPD base excision... Lus10027713 42.3 0.8108

Lus10007338 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.