Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42940 110 / 9e-30 AT-hook Predicted AT-hook DNA-binding family protein (.1) AT4G12050 69 / 4e-14 AT-hook Predicted AT-hook DNA-binding family protein (.1) AT2G45430 64 / 3e-12 AT-hook AHL22 AT-hook motif nuclear-localized protein 22 (.1) AT4G22810 64 / 4e-12 AT-hook Predicted AT-hook DNA-binding family protein (.1) AT4G14465 62 / 1e-11 AT-hook AHL20 AT-hook motif nuclear-localized protein 20 (.1) AT1G76500 56 / 1e-09 AT-hook SOB3, AHL29 SUPPRESSOR OF PHYB-4#3, AT-hook motif nuclear-localized protein 29, Predicted AT-hook DNA-binding family protein (.1) AT2G35270 55 / 4e-09 AT-hook GIK, 2-ATH, AHL21 GIANT KILLER, Predicted AT-hook DNA-binding family protein (.1) AT4G35390 54 / 1e-08 AT-hook AGF1 AT-hook protein of GA feedback 1 (.1) AT4G17800 53 / 2e-08 AT-hook Predicted AT-hook DNA-binding family protein (.1) AT3G55560 50 / 2e-07 AT-hook AHL15, AGF2 AT-hook motif nuclear-localized protein 15, AT-hook protein of GA feedback 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020763 [exp] 178 / 5e-56 AT2G42940 294 / 1e-100 Predicted AT-hook DNA-binding family protein (.1) Lus10031458 [exp] 71 / 2e-15 AT2G42940 212 / 1e-69 Predicted AT-hook DNA-binding family protein (.1) Lus10031460 [exp] 68 / 3e-14 AT2G42940 214 / 1e-70 Predicted AT-hook DNA-binding family protein (.1) Lus10002711 [exp] 61 / 4e-11 AT4G14465 211 / 1e-66 AT-hook motif nuclear-localized protein 20 (.1) Lus10000519 [exp] 61 / 4e-11 AT2G35270 205 / 1e-64 GIANT KILLER, Predicted AT-hook DNA-binding family protein (.1) Lus10015862 [exp] 61 / 6e-11 AT3G60870 227 / 1e-73 AT-hook motif nuclear-localized protein 18 (.1) Lus10042551 [exp] 59 / 2e-10 AT3G04570 202 / 4e-64 AT-hook motif nuclear-localized protein 19 (.1) Lus10006577 [exp] 59 / 2e-10 AT3G04570 270 / 1e-89 AT-hook motif nuclear-localized protein 19 (.1) Lus10009301 [exp] 59 / 2e-10 AT3G60870 223 / 4e-72 AT-hook motif nuclear-localized protein 18 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G059400 [exp] 145 / 3e-43 AT2G42940 311 / 2e-107 Predicted AT-hook DNA-binding family protein (.1) Potri.005G202700 [exp] 139 / 3e-41 AT2G42940 305 / 3e-105 Predicted AT-hook DNA-binding family protein (.1) Potri.003G116900 [exp] 75 / 3e-16 AT4G22810 258 / 5e-85 Predicted AT-hook DNA-binding family protein (.1) Potri.001G115200 [exp] 74 / 6e-16 AT4G22810 254 / 1e-83 Predicted AT-hook DNA-binding family protein (.1) Potri.010G074201 [exp] 73 / 1e-15 AT4G14465 256 / 3e-85 AT-hook motif nuclear-localized protein 20 (.1) Potri.008G164466 [exp] 72 / 1e-15 AT4G14465 184 / 3e-58 AT-hook motif nuclear-localized protein 20 (.1) Potri.002G149300 [exp] 69 / 3e-14 AT2G45430 226 / 1e-72 AT-hook motif nuclear-localized protein 22 (.1) Potri.014G070800 [exp] 68 / 1e-13 AT2G45430 222 / 5e-71 AT-hook motif nuclear-localized protein 22 (.1) Potri.010G200100 [exp] 68 / 1e-13 AT3G55560 209 / 2e-65 AT-hook motif nuclear-localized protein 15, AT-hook protein of GA feedback 2 (.1) Potri.013G044500 [exp] 67 / 1e-13 AT4G14465 162 / 3e-48 AT-hook motif nuclear-localized protein 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0615 [flax] [poplar] ALDC PF03479 [flax] [poplar] PCC Plants and Prokaryotes Conserved (PCC) domain
Representative CDS sequence Show only first row Show all	>Lus10007340 pacid=23166229 polypeptide=Lus10007340 locus=Lus10007340.g ID=Lus10007340.BGIv1.0 annot-version=v1.0 ATGGCTGGATTGGCAGATCAAAACACTCCTTGCTTAGGATACAACAGCAATATGGACTTCAACCATGAACCCGAAAAGGCCAATCACAGGCTGAGCATCG AGGCGAGCTTTGTATCCCCGAAGCTCCCTAAGGCTGTGACCCCCGTTTCGTCTGCACCCGAAGCCATTGTGACCCTCCACGGCCGATTCGAGATTCTCTC ATTGCTCGGATCCATTTTGCCACCTCCGGCACCTTCTGGCATCACGGGGCTGACAATCTATTTGGCTGGAGCTCAAGGCCAGGTGGTGGGTGGTTGTGTG GTTGGTGCACTTATAGCTTCTGGTCCTGTTGTGGTGATGGCGGCTTCTTTCATGAATGCGACTTTTGATCGGTTGCCTTTGGACGAGGAGGAGATTGCTG CCGCTGTCCAGAATCAGCATTACCAGAACGGCCGCCACCACCACCATCACCACCTTGATATGTCCGATGTGTTTGGGATTCCGCCGCAGAACTTGCTTAC TAATGGCTCGAACCCTCCTGAGATTTACTCGTGGGCCACCGGCCGAGCCGTCTCCAAATCCTAG
AA sequence Show only first row Show all	>Lus10007340 pacid=23166229 polypeptide=Lus10007340 locus=Lus10007340.g ID=Lus10007340.BGIv1.0 annot-version=v1.0 MAGLADQNTPCLGYNSNMDFNHEPEKANHRLSIEASFVSPKLPKAVTPVSSAPEAIVTLHGRFEILSLLGSILPPPAPSGITGLTIYLAGAQGQVVGGCV VGALIASGPVVVMAASFMNATFDRLPLDEEEIAAAVQNQHYQNGRHHHHHHLDMSDVFGIPPQNLLTNGSNPPEIYSWATGRAVSKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10007340 [exp]	0	1
AT3G11570		TBL8	TRICHOME BIREFRINGENCE-LIKE 8 ...		Lus10017004 [exp]	2.2	0.8146
AT5G16920			Fasciclin-like arabinogalactan...		Lus10039146 [exp]	2.4	0.8113
AT1G06340			Plant Tudor-like protein (.1)		Lus10009266 [exp]	3.5	0.8127
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10020763 [exp]	4.0	0.7552
AT3G13850	AS2	LBD22	LOB domain-containing protein ...		Lus10003789 [exp]	4.5	0.7875
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Lus10035802 [exp]	7.0	0.7595
AT2G34930			disease resistance family prot...		Lus10016342 [exp]	7.3	0.7518
AT5G63800		MUM2, BGAL6	MUCILAGE-MODIFIED 2, beta-gala...		Lus10033500 [exp]	8.9	0.7926
AT1G13570			F-box/RNI-like superfamily pro...		Lus10028368 [exp]	15.1	0.7116
AT3G48480			Cysteine proteinases superfami...		Lus10031938 [exp]	17.1	0.5841

Compare expression of checked genes

Lus10007340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.