Lus10007343 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020766 71 / 5e-16 AT4G21610 133 / 3e-40 lsd one like 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G043100 53 / 3e-09 AT4G21610 131 / 7e-40 lsd one like 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06943 zf-LSD1 LSD1 zinc finger
Representative CDS sequence
>Lus10007343 pacid=23166249 polypeptide=Lus10007343 locus=Lus10007343.g ID=Lus10007343.BGIv1.0 annot-version=v1.0
ATGGAGAACGTATCAGAATCTATGGAGGATATCGAACCACCACCTCCGGGGTGGGAATCGATCCCCCCGTCCCAGCCATCGCTGCAACCTGCTGCTCTCC
CGGCGCCGCAATCGATTTCCCCGTCACAGCCATCCGAACAACCTACTACTCTTCCTCCACCGCCGTCTTCCCCGCCGGCGTTACCCCAACTTCAGCCACA
ATCAGCTCATGAAGTTGGACTTGTTAACTGTGGTAGCTGTCCTACTCTGCTTATGTACCCTTATGGATCCACCTCAGTTAGTTGCTCATCTTGCCAGTCG
GTGACAGAAATTGGAACTAATACCTACATGATCTGTCATGATGTTATTGATTATTTCATTTTAACCATTACGATTGAACAAAGGTTGACTGTGGTTCACG
CATCTTCTGTGCAGGAACATAATCAACGTCCACCATGGTCTGTGATACAAGGACACCCTAACATTGTTCACTGA
AA sequence
>Lus10007343 pacid=23166249 polypeptide=Lus10007343 locus=Lus10007343.g ID=Lus10007343.BGIv1.0 annot-version=v1.0
MENVSESMEDIEPPPPGWESIPPSQPSLQPAALPAPQSISPSQPSEQPTTLPPPPSSPPALPQLQPQSAHEVGLVNCGSCPTLLMYPYGSTSVSCSSCQS
VTEIGTNTYMICHDVIDYFILTITIEQRLTVVHASSVQEHNQRPPWSVIQGHPNIVH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21610 LOL2 lsd one like 2 (.1) Lus10007343 0 1
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10018191 6.1 0.8886
AT5G23570 SGS3, ATSGS3 SUPPRESSOR OF GENE SILENCING 3... Lus10004301 6.9 0.8749
AT5G19580 glyoxal oxidase-related protei... Lus10011109 11.6 0.8370
AT5G26749 C2H2 and C2HC zinc fingers sup... Lus10001520 13.0 0.8620
AT5G01910 unknown protein Lus10022734 13.3 0.8777
AT1G80660 AHA9 H\(+\)-ATPase 9, H\(+\)-ATPase... Lus10002326 17.0 0.8653
AT4G37090 unknown protein Lus10000742 17.7 0.8584
AT1G19990 unknown protein Lus10033141 17.7 0.8733
AT4G10630 Glutaredoxin family protein (.... Lus10008270 21.9 0.8721
AT4G22860 Cell cycle regulated microtubu... Lus10007022 24.0 0.8559

Lus10007343 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.