Lus10007349 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 358 / 7e-125 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 352 / 9e-123 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 348 / 2e-121 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 343 / 3e-119 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT4G30270 332 / 3e-115 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57550 332 / 1e-114 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57530 324 / 1e-111 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 322 / 5e-111 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT2G18800 314 / 2e-107 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT5G48070 310 / 3e-106 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020772 486 / 1e-175 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 484 / 1e-174 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 426 / 9e-152 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10007348 431 / 1e-151 AT3G23730 355 / 2e-121 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 426 / 1e-151 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 423 / 7e-151 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 422 / 2e-150 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031392 419 / 2e-149 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 414 / 2e-147 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G060500 402 / 2e-142 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 397 / 1e-140 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 395 / 2e-139 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 389 / 2e-137 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 383 / 4e-135 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 377 / 1e-132 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 360 / 9e-126 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.013G005700 356 / 1e-123 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 350 / 3e-122 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 347 / 5e-121 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10007349 pacid=23166255 polypeptide=Lus10007349 locus=Lus10007349.g ID=Lus10007349.BGIv1.0 annot-version=v1.0
ATGGCTGCCGTTCTTCCTTGGGTCACATTGTTGCTATTGGGTCATCTACTAACAATCTCAGAAGCCAACTTCAACCAACAGTTCGATATCACGTTCGGAG
ATCAACGCGCCCAGATTCAAAACGGAGGCCAACAACTCACTCTCTCGCTGGACAAGTTCTCAGGTTCCGGATTCAAGTCCAAGAGCGAGTACCTCTTCGG
CCGCATCGATATGCAGATCAAGCTCGTCGCAGGCAACTCTGCTGGCACCGTCACCACTTTCTACTTGTCCTCCGAAGGAGCAAACCACGACGAGATCGAC
TTCGAATTCCTAGGGAACTCATCGGGCGATCCGTACCTTATCCATACAAATGTGTTCGCGCAGGGGAAGGGAAACAGAGAACAACAATTCTATCTCTGGT
TTGACCCAACCTCTGCTTTCCACACTTACACCATCCTCTGGAATCCCCAACGAATCATATTCTTGGTGGACAACATACCGTTGAGGGTGCACAATAACCT
GGAATCAAAGGGAGTGCCGTACCCAAACAAGCAGCCGATGAAGATATACTCGAGTCTATGGAATGCGGATGACTGGGCGACTCAAGGCGGACGAGTGAAG
ACTGACTGGACCAAAGCTCCTTTCGTGGCTTCGTACAGGAACTTCAGGGCTGATGCATGCGTTTGGTCCTCTGGTGCTTCTTCTTGTGGTTCATCTTCTG
GAAATGGGTTGCAGAATGGAGCTTGGCAGACTCAGGATTTGGATGCTGCCGGAAGGAATAGGCTCCGCTGGGTGCAGAGCAAGTATCTTGTTTACAACTA
TTGTACAGATTTCAAGCGATTTCCTCAGGGCTTGCCCATTGAGTGTTCGCGGTGA
AA sequence
>Lus10007349 pacid=23166255 polypeptide=Lus10007349 locus=Lus10007349.g ID=Lus10007349.BGIv1.0 annot-version=v1.0
MAAVLPWVTLLLLGHLLTISEANFNQQFDITFGDQRAQIQNGGQQLTLSLDKFSGSGFKSKSEYLFGRIDMQIKLVAGNSAGTVTTFYLSSEGANHDEID
FEFLGNSSGDPYLIHTNVFAQGKGNREQQFYLWFDPTSAFHTYTILWNPQRIIFLVDNIPLRVHNNLESKGVPYPNKQPMKIYSSLWNADDWATQGGRVK
TDWTKAPFVASYRNFRADACVWSSGASSCGSSSGNGLQNGAWQTQDLDAAGRNRLRWVQSKYLVYNYCTDFKRFPQGLPIECSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10007349 0 1
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10020772 1.0 0.9742
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10007348 2.0 0.9393
AT5G01380 Trihelix Homeodomain-like superfamily p... Lus10004806 3.2 0.8681
AT4G08950 EXO EXORDIUM, Phosphate-responsive... Lus10021370 3.5 0.9036
AT4G17140 pleckstrin homology (PH) domai... Lus10003381 6.0 0.8749
AT4G08950 EXO EXORDIUM, Phosphate-responsive... Lus10017050 6.3 0.9031
AT5G39670 Calcium-binding EF-hand family... Lus10007536 7.5 0.8779
AT5G18150 Methyltransferase-related prot... Lus10034423 8.1 0.9037
AT1G15380 GLYI4 glyoxylase I 4, Lactoylglutath... Lus10025971 10.5 0.8677
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10010938 10.6 0.8756

Lus10007349 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.