Lus10007373 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65820 207 / 5e-70 microsomal glutathione s-transferase, putative (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020793 246 / 2e-85 AT1G65820 218 / 3e-74 microsomal glutathione s-transferase, putative (.1.2.3)
Lus10007375 235 / 6e-81 AT1G65820 222 / 7e-76 microsomal glutathione s-transferase, putative (.1.2.3)
Lus10020792 220 / 1e-74 AT1G65820 171 / 1e-55 microsomal glutathione s-transferase, putative (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G140900 207 / 1e-69 AT1G65820 217 / 1e-73 microsomal glutathione s-transferase, putative (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01124 MAPEG MAPEG family
Representative CDS sequence
>Lus10007373 pacid=23166213 polypeptide=Lus10007373 locus=Lus10007373.g ID=Lus10007373.BGIv1.0 annot-version=v1.0
ATGGCCGCCGGCGCCGGAGTTACAGAATTGCTGCCCAAGGAGTACGGCTACGTGGCTCTAGTGGTAGTGGCCTGTCGCTTGCTGAGTTTTTACATGGCAC
GCAAGGTCGTCAGGGCTCGTATGAAATACAACGTCCCTTATCCCACTCTCTACGCAATTGAATCAGAGAACAAACACGCTAAGCTCTTCAACTGCGTACA
GAGAGGGCACCAGAATTCGCTGGAATTGATGCCGATGTTCTTCATGCTGATCGCGTTGGGAGGATTGAGGCATCCCTGCGTCGCCGCCGCTCTCGGAGCG
TTCTTCGTCGTGACTCGTTACTTCTATTTCACCGGCTACTCCACCGGAGATCCCAAGAATCGCCTCCCCATAGGTAAATACGGGTTCTTGTCCCTCTTTG
GGCTAATGGGTTGCACTATTTCCCTCGGCATCACCCTCCTACGAGCATAG
AA sequence
>Lus10007373 pacid=23166213 polypeptide=Lus10007373 locus=Lus10007373.g ID=Lus10007373.BGIv1.0 annot-version=v1.0
MAAGAGVTELLPKEYGYVALVVVACRLLSFYMARKVVRARMKYNVPYPTLYAIESENKHAKLFNCVQRGHQNSLELMPMFFMLIALGGLRHPCVAAALGA
FFVVTRYFYFTGYSTGDPKNRLPIGKYGFLSLFGLMGCTISLGITLLRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65820 microsomal glutathione s-trans... Lus10007373 0 1
AT5G03680 Trihelix PTL PETAL LOSS, Duplicated homeodo... Lus10035570 5.5 0.7571
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Lus10032561 6.9 0.7555
AT5G19090 Heavy metal transport/detoxifi... Lus10029942 9.8 0.6947
AT5G03680 Trihelix PTL PETAL LOSS, Duplicated homeodo... Lus10027718 17.9 0.7343
AT4G05400 copper ion binding (.1.2) Lus10035454 18.8 0.7254
AT2G24580 FAD-dependent oxidoreductase f... Lus10026231 20.9 0.7484
AT1G05710 bHLH bHLH153 basic helix-loop-helix (bHLH) ... Lus10027064 25.8 0.7296
Lus10023658 26.4 0.6348
AT4G40060 HD ATHB16 ,ATHB-16 homeobox protein 16 (.1) Lus10023159 28.5 0.7082
AT2G15220 Plant basic secretory protein ... Lus10038602 32.9 0.6481

Lus10007373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.