Lus10007375 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65820 223 / 6e-76 microsomal glutathione s-transferase, putative (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020793 284 / 4e-100 AT1G65820 218 / 3e-74 microsomal glutathione s-transferase, putative (.1.2.3)
Lus10007373 235 / 7e-81 AT1G65820 207 / 5e-70 microsomal glutathione s-transferase, putative (.1.2.3)
Lus10020792 178 / 4e-58 AT1G65820 171 / 1e-55 microsomal glutathione s-transferase, putative (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G140900 222 / 2e-75 AT1G65820 217 / 1e-73 microsomal glutathione s-transferase, putative (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01124 MAPEG MAPEG family
Representative CDS sequence
>Lus10007375 pacid=23166217 polypeptide=Lus10007375 locus=Lus10007375.g ID=Lus10007375.BGIv1.0 annot-version=v1.0
ATGGCGGCCGTCGGAGTTGCGGATTTGCTACCCAAGGAGTACGGCTACGTGGCTCTGGTGCTAGTGGCGTACTGCTTTCTGAATATATTCATGATGATCC
AGGTCGGGCAGGCTCGCAAGAAGTACAAAGTCCCGTATCCCACTCTCTACGCCATTGAATCTGAGAACAAAGATGCTAAACTCTTCAACTGCGTTCAGAG
AGGGCACCAGAACTCGCTGGAGTTCATGCCAATGTTCTTTACTCTGTTGGCGATTGGAGGACTGAGGCATCCCTGCGTCGCCGCCGCTTTCGGCGCTTTG
TTCACCGTAACTCGCTACTTCTATTTCACCGGCTACTCCACCGGCGATCCCAAAAACCGCCTCACCATCGGTAAATACGGGTTCTTGTTCATCTTGGGGC
TAATGGGTTGCACAATTTCCCTTGGCATCACCCTCCTCCTACGGGCATAG
AA sequence
>Lus10007375 pacid=23166217 polypeptide=Lus10007375 locus=Lus10007375.g ID=Lus10007375.BGIv1.0 annot-version=v1.0
MAAVGVADLLPKEYGYVALVLVAYCFLNIFMMIQVGQARKKYKVPYPTLYAIESENKDAKLFNCVQRGHQNSLEFMPMFFTLLAIGGLRHPCVAAAFGAL
FTVTRYFYFTGYSTGDPKNRLTIGKYGFLFILGLMGCTISLGITLLLRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65820 microsomal glutathione s-trans... Lus10007375 0 1
AT3G21760 HYR1 HYPOSTATIN RESISTANCE 1, UDP-G... Lus10036086 3.7 0.9712
AT1G07250 UGT71C4 UDP-glucosyl transferase 71C4 ... Lus10003805 9.5 0.9442
AT3G58480 calmodulin-binding family prot... Lus10013759 9.6 0.9553
AT1G27450 APRT, ATAPT1, A... ARABIDOPSIS THALIANA ADENINE P... Lus10018695 10.4 0.9613
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10031388 11.3 0.9626
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10000242 11.5 0.9473
AT5G39160 RmlC-like cupins superfamily p... Lus10042517 12.0 0.9129
AT2G29420 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, ... Lus10040765 13.9 0.9522
AT5G64250 Aldolase-type TIM barrel famil... Lus10003271 14.3 0.9525
Lus10018014 16.6 0.9275

Lus10007375 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.