Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49410 66 / 7e-16 TOM6 translocase of the outer mitochondrial membrane 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020801 [exp] 91 / 1e-25 AT1G49410 73 / 1e-19 translocase of the outer mitochondrial membrane 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G149200 [exp] 76 / 7e-20 AT1G49410 96 / 1e-28 translocase of the outer mitochondrial membrane 6 (.1) Potri.009G110100 [exp] 74 / 5e-19 AT1G49410 92 / 4e-27 translocase of the outer mitochondrial membrane 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007383 pacid=23166192 polypeptide=Lus10007383 locus=Lus10007383.g ID=Lus10007383.BGIv1.0 annot-version=v1.0 ATGAAACAGTTTCGGCCGAAACCCAAAAGCCCACTAATTTTCGTCTCTTGCTCCGTTGGTTTTAGGGTTTTAGCGAAAAGTCCAGAGAAAAGAAGTTGTG CTGCTCACTCGTCGGCGATCATGTTTCCGGGGATGTTCATGAAGAAGCCGGACAAGGCTGCAGCATATAAGGAGCTGAAATACCACGCCGCGATGTTCAC TGCCTGGGTCGCCATCATCCGTGTCACTCCTTACCTTCTCCATTACCTCTCCGCCGCTGAGAAGGAAGAGCTCAAGCTCGAGTTCTAG
AA sequence Show only first row Show all	>Lus10007383 pacid=23166192 polypeptide=Lus10007383 locus=Lus10007383.g ID=Lus10007383.BGIv1.0 annot-version=v1.0 MKQFRPKPKSPLIFVSCSVGFRVLAKSPEKRSCAAHSSAIMFPGMFMKKPDKAAAYKELKYHAAMFTAWVAIIRVTPYLLHYLSAAEKEELKLEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G49410		TOM6	translocase of the outer mitoc...		Lus10007383 [exp]	0	1
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10032280 [exp]	9.2	0.9548
AT1G05205			unknown protein		Lus10027173 [exp]	10.4	0.9025
AT3G10610			Ribosomal S17 family protein (...		Lus10016985 [exp]	13.7	0.9147
AT1G49410		TOM6	translocase of the outer mitoc...		Lus10020801 [exp]	15.1	0.9454
AT4G37580		UNS2, COP3, HLS...	UNUSUAL SUGAR RESPONSE 2, HOOK...		Lus10016904 [exp]	15.3	0.9489
					Lus10030724 [exp]	18.5	0.8542
					Lus10006316 [exp]	19.7	0.8874
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Lus10028748 [exp]	20.3	0.8778
AT3G52680			F-box/RNI-like/FBD-like domain...		Lus10029997 [exp]	21.1	0.8683
AT3G18960	B3		AP2/B3-like transcriptional fa...		Lus10012046 [exp]	23.1	0.9442

Compare expression of checked genes

Lus10007383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.