Lus10007388 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52640 194 / 2e-58 Zn-dependent exopeptidases superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020806 332 / 5e-111 AT3G52640 741 / 0.0 Zn-dependent exopeptidases superfamily protein (.1.2.3)
Lus10007387 309 / 3e-102 AT3G52640 830 / 0.0 Zn-dependent exopeptidases superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G082900 223 / 4e-69 AT3G52640 835 / 0.0 Zn-dependent exopeptidases superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10007388 pacid=23166220 polypeptide=Lus10007388 locus=Lus10007388.g ID=Lus10007388.BGIv1.0 annot-version=v1.0
ATGGCTGATGCTGCTCAGCTGAGCTTACCGGAGAACCCCAATTTCTCAGCTCCTTTCATCAATCGCATTTTTTCTTTCCGACGCTTATGCTCTGCTCTTT
CTGCTCCGATGAACTTCTACTTCTCATTAGTAGTGTTTCTATTTCTCTCGAGATGCATCCGCGGAATCTCCGGACAAGCAAAATCAATGGAGTCCGTTCC
TGATCTGCATAATTCGATGTACAAGGTCGTCGATGGCTTACCCTGCGTTCGACTGCTCAATCTTTCTGGGGAAATAGGCTGTGCTAATCCCGGGAGAGAC
AAGGTTGTAGCTCCCGTTGTGAGATATCAATCTGGTCTTGATTTGGCTCTTCCTTCGGCTGTTCTGGTGTCGCTCGATGGAATTGGTGAACTCTTTGATA
GAATATCGAAAGACTCGGCGCTTTCAAAGAACATTGGTGGTATTTTAGTTGAATCTGGAACTGATACTCGCAGCAAACTGAGAGGATTCTCTCCTGATTA
CAAGTTCCCACAAGCTGAATTTTCCCCTTATCAGAAGACCGATTACAAGTGGAATCCTATGGGATCTGGTATAATGTGGAAAAATTATGATTTTCCAATC
TTCTTACTGACTGAGAATAGCACACAGATCATGAAAGAGGTAACACCAATAGTTCTCTAG
AA sequence
>Lus10007388 pacid=23166220 polypeptide=Lus10007388 locus=Lus10007388.g ID=Lus10007388.BGIv1.0 annot-version=v1.0
MADAAQLSLPENPNFSAPFINRIFSFRRLCSALSAPMNFYFSLVVFLFLSRCIRGISGQAKSMESVPDLHNSMYKVVDGLPCVRLLNLSGEIGCANPGRD
KVVAPVVRYQSGLDLALPSAVLVSLDGIGELFDRISKDSALSKNIGGILVESGTDTRSKLRGFSPDYKFPQAEFSPYQKTDYKWNPMGSGIMWKNYDFPI
FLLTENSTQIMKEVTPIVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52640 Zn-dependent exopeptidases sup... Lus10007388 0 1
AT5G62600 MOS14 modifier of snc1-1, 14, ARM re... Lus10042159 1.4 0.9198
AT5G58100 unknown protein Lus10027581 2.0 0.9046
AT3G57570 ARM repeat superfamily protein... Lus10042364 3.2 0.9011
AT1G08600 ATRX, CHR20 P-loop containing nucleoside t... Lus10003572 6.0 0.9030
AT2G47980 SCC3, ATSCC3 sister-chromatid cohesion prot... Lus10008306 6.3 0.9020
AT2G36850 CHOR, ATGSL8, A... CHORUS, glucan synthase-like 8... Lus10040891 7.7 0.8969
AT5G36930 Disease resistance protein (TI... Lus10011741 11.8 0.8953
AT3G59410 ATGCN2, GCN2 ARABIDOPSIS THALIANA GENERAL C... Lus10014896 12.3 0.8909
AT5G56930 C3HZnF EMB1789 embryo defective 1789, CCCH-ty... Lus10028950 12.8 0.8866
AT5G06120 ARM repeat superfamily protein... Lus10041603 13.1 0.8899

Lus10007388 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.