Lus10007389 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13940 56 / 1e-10 DNA binding;DNA-directed RNA polymerases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029818 133 / 1e-38 AT3G13940 327 / 4e-108 DNA binding;DNA-directed RNA polymerases (.1)
Lus10020738 131 / 2e-38 AT3G13940 319 / 1e-105 DNA binding;DNA-directed RNA polymerases (.1)
Lus10027606 90 / 9e-25 ND 38 / 6e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G198600 69 / 4e-15 AT3G13940 328 / 4e-108 DNA binding;DNA-directed RNA polymerases (.1)
PFAM info
Representative CDS sequence
>Lus10007389 pacid=23166216 polypeptide=Lus10007389 locus=Lus10007389.g ID=Lus10007389.BGIv1.0 annot-version=v1.0
ATGGCGAATCAGCATCAGCGGCGTGGTCGGGGTGGAGGCCGTCGGGATGACTTTGAGAGTGATACTCTGGCTGGAATTTTTTGCTACATAACGCATCTGG
TGAAGTTCATGGCCTTGCAATACATGGATAGTGCAGCAGCTGCGAGAAATCACAGATTCCCACACTACTTTAAGGATAAGTTTCAGGAGATGTTCAATCA
GGTGGGGGAGACAAGAAGAATGCCGAGTGATAAACAGAATCTGCTGATTTGA
AA sequence
>Lus10007389 pacid=23166216 polypeptide=Lus10007389 locus=Lus10007389.g ID=Lus10007389.BGIv1.0 annot-version=v1.0
MANQHQRRGRGGGRRDDFESDTLAGIFCYITHLVKFMALQYMDSAAAARNHRFPHYFKDKFQEMFNQVGETRRMPSDKQNLLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13940 DNA binding;DNA-directed RNA p... Lus10007389 0 1

Lus10007389 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.