Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036108 [exp] 63 / 1e-13 AT2G28470 661 / 0.0 beta-galactosidase 8 (.1.2) Lus10000271 [exp] 61 / 6e-13 AT2G28470 1046 / 0.0 beta-galactosidase 8 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007398 pacid=23175820 polypeptide=Lus10007398 locus=Lus10007398.g ID=Lus10007398.BGIv1.0 annot-version=v1.0 ATGGTACCCATCAAGGAAGCTGTGGATGCTTCAGGAATGGGAGATTGCCATAGCAAGAATACTCTATCCATTATAGAAGGGAGCACATTTGGCGTACCTT GTGGTCGAGTTCGTAAGAATTTTGCAGTGGAAGTATCATGTACTGCTGCTGAACATTGA
AA sequence Show only first row Show all	>Lus10007398 pacid=23175820 polypeptide=Lus10007398 locus=Lus10007398.g ID=Lus10007398.BGIv1.0 annot-version=v1.0 MVPIKEAVDASGMGDCHSKNTLSIIEGSTFGVPCGRVRKNFAVEVSCTAAEH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007398 [exp]	0	1
AT1G09190			Tetratricopeptide repeat (TPR)...		Lus10034889 [exp]	1.0	0.9962
					Lus10011992 [exp]	16.1	0.8330
AT4G34190		SEP1	stress enhanced protein 1 (.1)		Lus10002818 [exp]	21.4	0.8465
AT4G35150			O-methyltransferase family pro...		Lus10017699 [exp]	22.4	0.9131
AT1G70580		GGT2, AOAT2	GLUTAMATE:GLYOXYLATE AMINOTRAN...		Lus10036850 [exp]	27.8	0.9119
AT1G18400	bHLH	bHLH044, BEE1	BR enhanced expression 1 (.1)		Lus10017602 [exp]	30.3	0.9096
AT1G18400	bHLH	bHLH044, BEE1	BR enhanced expression 1 (.1)		Lus10033562 [exp]	36.3	0.9078
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031145 [exp]	38.8	0.9070
AT2G24180		CYP71B6	cytochrome p450 71b6 (.1)		Lus10017697 [exp]	43.2	0.9068
AT1G72490			unknown protein		Lus10037689 [exp]	44.7	0.9067

Compare expression of checked genes

Lus10007398 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.