Gene [FLAX] | FIBexDB

Lus10007406 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10013060 [exp]	76 / 4e-17	AT3G44970	148 / 5e-40	Cytochrome P450 superfamily protein (.1)
Lus10029539 [exp]	69 / 1e-15	AT3G56570	45 / 7e-06	SET domain-containing protein (.1)
Lus10042593 [exp]	68 / 2e-14	AT4G02780	808 / 0.0	GA REQUIRING 1, CPP synthase, ARABIDOPSIS THALIANA ENT-COPALYL DIPHOSPHATE SYNTHETASE 1, Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Lus10000825 [exp]	60 / 6e-12	ND	/
Lus10009781 [exp]	58 / 2e-11	ND	/
Lus10001867 [exp]	51 / 9e-09	ND	/
Lus10003369 [exp]	51 / 1e-08	ND	/
Lus10011605 [exp]	45 / 2e-06	ND	/
Lus10020159 [exp]	41 / 5e-05	AT4G31350	423 / 4e-146	Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein (.1.2)

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10007406 pacid=23175819 polypeptide=Lus10007406 locus=Lus10007406.g ID=Lus10007406.BGIv1.0 annot-version=v1.0

ATGTCAGAGACTTTGGAGCTTGGGTCGGAAGACATAATCAAGATTGACAGATCGATTTCTTCAATGGTTCTCGGCGAAATTAGGTTTTTCGGATTTCTTC

TTAGCATTTGGAGTCCGAGAAAGGAAGTCGAAGTTGGAGTTGGCAGAGCAGAGGTACTGCACGTCGTGCAGTCCATCAAGTATTTCAAAGGCACGGCTTC

AACACAAGCGCACGGCGTGCAACAGAGCACGCCGTTCCTTGCTTTTGGAGTCGACGAATTAGGGAGATTTGAAGCAGCACGGCGTGCACCACTGCACGCC

GTTCCAACCTTTTGGCGTCGCAGTATGGAGAAGGATTGA

AA sequence

Show only first row Show all

>Lus10007406 pacid=23175819 polypeptide=Lus10007406 locus=Lus10007406.g ID=Lus10007406.BGIv1.0 annot-version=v1.0

MSETLELGSEDIIKIDRSISSMVLGEIRFFGFLLSIWSPRKEVEVGVGRAEVLHVVQSIKYFKGTASTQAHGVQQSTPFLAFGVDELGRFEAARRAPLHA

VPTFWRRSMEKD

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007406 [exp]	0	1

Lus10007406 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.