Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09740 64 / 3e-13 ATSYP71, SYP71 syntaxin of plants 71 (.1) AT3G45280 63 / 6e-13 ATSYP72, SYP72 syntaxin of plants 72 (.1) AT3G61450 41 / 4e-05 ATSYP73, SYP73 syntaxin of plants 73 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036118 [exp] 103 / 4e-28 AT3G45280 363 / 3e-127 syntaxin of plants 72 (.1) Lus10036377 [exp] 63 / 2e-12 AT3G09740 347 / 8e-117 syntaxin of plants 71 (.1) Lus10014759 [exp] 62 / 3e-12 AT3G09740 308 / 4e-102 syntaxin of plants 71 (.1) Lus10023178 [exp] 59 / 4e-11 AT3G09740 416 / 1e-148 syntaxin of plants 71 (.1) Lus10015075 [exp] 58 / 5e-11 AT3G09740 417 / 3e-149 syntaxin of plants 71 (.1) Lus10019925 [exp] 57 / 1e-10 AT3G09740 419 / 2e-149 syntaxin of plants 71 (.1) Lus10026495 [exp] 57 / 1e-10 AT3G09740 408 / 5e-145 syntaxin of plants 71 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G129500 [exp] 37 / 0.0001 AT3G09740 377 / 3e-133 syntaxin of plants 71 (.1) Potri.016G088200 [exp] 39 / 0.0002 AT3G09740 384 / 3e-136 syntaxin of plants 71 (.1) Potri.014G087400 [exp] 39 / 0.0004 AT3G09740 352 / 2e-123 syntaxin of plants 71 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007411 pacid=23175826 polypeptide=Lus10007411 locus=Lus10007411.g ID=Lus10007411.BGIv1.0 annot-version=v1.0 ATGTCTTCGCTCGCCTTTACGCCACCGTCGAGGCTGAGATTGAAGCCGCTATGGGTAAAGCCGATAGGGCTTCAAAGGAGAGCAAAAAATGCTGAGATTC GCAAGACCAAGACTCGGTTGATGGATGAAGTTATCAAACTTCAAAAGTTGGCTCTCAAGAGGGAGTTGGACAGACAAGTTCCCTTCATGTATGAGATTGA CACAAAGATGAGATCCAGTCGCAACTTCTGCATTGAGATTATCTTGCTTTGTGTAATCCTAGGAATTGCTTCCTACATATACAAGTATGTTCCTTGTGGT CGATCATGCATGTCTCTCTTTAATCAGCTTTTGGATGGATATTTAGCAATAGATCAGTGCTAA
AA sequence Show only first row Show all	>Lus10007411 pacid=23175826 polypeptide=Lus10007411 locus=Lus10007411.g ID=Lus10007411.BGIv1.0 annot-version=v1.0 MSSLAFTPPSRLRLKPLWVKPIGLQRRAKNAEIRKTKTRLMDEVIKLQKLALKRELDRQVPFMYEIDTKMRSSRNFCIEIILLCVILGIASYIYKYVPCG RSCMSLFNQLLDGYLAIDQC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09740		ATSYP71, SYP71	syntaxin of plants 71 (.1)		Lus10007411 [exp]	0	1
AT1G70870			Polyketide cyclase/dehydrase a...		Lus10008931 [exp]	1.0	0.8126
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10021300 [exp]	22.1	0.7756
					Lus10019353 [exp]	32.9	0.7996
AT1G50670			OTU-like cysteine protease fam...		Lus10040075 [exp]	39.2	0.7708
AT5G14850			Alg9-like mannosyltransferase ...		Lus10034759 [exp]	42.0	0.7405
AT3G14770		SWEET2, AtSWEET...	Nodulin MtN3 family protein (....		Lus10002783 [exp]	42.0	0.7635
AT5G14710			unknown protein		Lus10014543 [exp]	47.0	0.7382
AT5G04980			DNAse I-like superfamily prote...		Lus10028884 [exp]	58.0	0.7539
AT1G25260			Ribosomal protein L10 family p...		Lus10030073 [exp]	61.5	0.7700
					Lus10007187 [exp]	66.8	0.6945

Compare expression of checked genes

Lus10007411 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.