Lus10007414 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034553 49 / 1e-07 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007414 pacid=23180216 polypeptide=Lus10007414 locus=Lus10007414.g ID=Lus10007414.BGIv1.0 annot-version=v1.0
ATGCAAAAGCTGTTGAAGGGTGGGAAAGTAATATCACTGTTTTTTGAGAACTATGGAGATTATCTAAACAAAAATCTGGTGGATGGCTTAAAACCAAGCA
GATGGGTCTTCCCGTTGCGAATAGCTGGTGAACTGCACAACAAGATTACGACAGGTATGAAGGTATCGACGTCGAGATTTGGGAAGACAACATATGAACT
TATTCATAAGAAGCATTGGTTGGTTGGTGTCGATGACATTACAGGCGCCTGTGAATTTCTCTTCATCATCAACACAAAAGACAAGTGTTATGAAGTTGAT
GACACTAGGGGTGCAAAAGATTTCAAGAAAAAATGGAAGAAAACCGGAGATGTTTTGGTGAGTTATGTGAAAAAATATTACAGTGTTGTTCAGAAAGTGG
AGGATTTCAGTGTCTACAAGTGGTATGTCTTTGAAGATGTGGACCTTGAAGATGCCTCAAATAATAACAGAGTGTTGGACATAATGGAATGCTGGTGTGG
CGGAGTTGAAATGCCAATAAATTAG
AA sequence
>Lus10007414 pacid=23180216 polypeptide=Lus10007414 locus=Lus10007414.g ID=Lus10007414.BGIv1.0 annot-version=v1.0
MQKLLKGGKVISLFFENYGDYLNKNLVDGLKPSRWVFPLRIAGELHNKITTGMKVSTSRFGKTTYELIHKKHWLVGVDDITGACEFLFIINTKDKCYEVD
DTRGAKDFKKKWKKTGDVLVSYVKKYYSVVQKVEDFSVYKWYVFEDVDLEDASNNNRVLDIMECWCGGVEMPIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007414 0 1
AT2G48140 EDA4 embryo sac development arrest ... Lus10042613 1.0 0.9796
AT4G30590 AtENODL12 early nodulin-like protein 12 ... Lus10019955 1.4 0.8420
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021543 9.9 0.7150
Lus10017410 10.0 0.6902
Lus10000351 11.5 0.7150
Lus10002886 12.8 0.7150
AT5G02930 F-box/RNI-like superfamily pro... Lus10032255 14.1 0.7150
AT5G66870 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAI... Lus10006679 15.2 0.7150
AT5G03340 ATPase, AAA-type, CDC48 protei... Lus10041332 16.2 0.7150
AT3G26880 Plant self-incompatibility pro... Lus10022631 17.2 0.7150

Lus10007414 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.