Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05800 49 / 2e-07 unknown protein AT3G11290 48 / 3e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024453 [exp] 237 / 4e-82 AT5G05800 50 / 7e-08 unknown protein Lus10025958 [exp] 82 / 2e-19 AT2G24960 102 / 4e-24 unknown protein Lus10014257 [exp] 77 / 2e-17 AT3G14820 282 / 1e-89 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10002039 [exp] 72 / 8e-16 AT3G11290 91 / 2e-20 unknown protein Lus10024329 [exp] 71 / 2e-15 AT5G05800 81 / 7e-17 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G135901 [exp] 167 / 8e-55 AT5G05800 44 / 1e-05 unknown protein Potri.002G023800 [exp] 83 / 5e-20 AT2G24960 89 / 2e-19 unknown protein Potri.017G120900 [exp] 41 / 7e-05 AT2G24960 50 / 1e-06 unknown protein Potri.004G172900 [exp] 39 / 0.0003 AT2G24960 96 / 1e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007443 pacid=23178399 polypeptide=Lus10007443 locus=Lus10007443.g ID=Lus10007443.BGIv1.0 annot-version=v1.0 ATGGCTTATGCGGATGAAGATGTTTCTTCGGGTTCCGCAGATGGTGTTAACATGGTAGATGGAAACAACAACAAGCGGCAAACTGGAACACCAGCTGGCT CTGGTCGTAACAAGAGAGGCCGGAAGGCTACTGGTGATGCCATTGTGGATGCCATGCTTGAAATTGCTGCAGCATCCAAATTGCGGGCAGCCGCCATCAT GAAGAGTGAGGATCAATTTTCTATTAGCAAATGTATCAAAGTATTGGATGAGATTCAGGATGTTGATCAACCGGTTTACTTTTTTGCGCTGGAACTATTT GAGAACCCTGATGCTCGAGAGATTTTTATATCCCTTAAGAATGAGAGACGGCTCCCTTGGTTACAGGGAAAGTATAGTGCCAGCTCTAAATGA
AA sequence Show only first row Show all	>Lus10007443 pacid=23178399 polypeptide=Lus10007443 locus=Lus10007443.g ID=Lus10007443.BGIv1.0 annot-version=v1.0 MAYADEDVSSGSADGVNMVDGNNNKRQTGTPAGSGRNKRGRKATGDAIVDAMLEIAAASKLRAAAIMKSEDQFSISKCIKVLDEIQDVDQPVYFFALELF ENPDAREIFISLKNERRLPWLQGKYSASSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05800			unknown protein		Lus10007443 [exp]	0	1
AT1G69630			F-box/RNI-like superfamily pro...		Lus10024695 [exp]	2.0	0.7965
AT4G02750			Tetratricopeptide repeat (TPR)...		Lus10017298 [exp]	4.5	0.6755
AT5G09450			Tetratricopeptide repeat (TPR)...		Lus10034221 [exp]	7.2	0.7321
AT2G36230		HISN3, APG10	ALBINO AND PALE GREEN 10, Aldo...		Lus10017042 [exp]	9.4	0.7642
AT4G24320			Ubiquitin carboxyl-terminal hy...		Lus10027445 [exp]	10.5	0.6741
AT4G27680			P-loop containing nucleoside t...		Lus10022361 [exp]	11.0	0.7168
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Lus10035128 [exp]	17.7	0.7393
AT3G01820			P-loop containing nucleoside t...		Lus10032057 [exp]	24.7	0.6645
AT5G63310		NDPK1A, NDPKIAI...	NDP KINASE 1A, NUCLEOSIDE DIPH...		Lus10017931 [exp]	26.2	0.7114
AT2G28070		ABCG3	ATP-binding cassette G3, ABC-2...		Lus10041334 [exp]	27.7	0.6961

Compare expression of checked genes

Lus10007443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.