Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29170 124 / 5e-38 Eukaryotic protein of unknown function (DUF872) (.1) AT4G29850 58 / 3e-12 Eukaryotic protein of unknown function (DUF872) (.1) AT2G19350 54 / 1e-10 Eukaryotic protein of unknown function (DUF872) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028939 [exp] 150 / 3e-45 AT3G29170 80 / 3e-18 Eukaryotic protein of unknown function (DUF872) (.1) Lus10019737 [exp] 58 / 4e-12 AT4G29850 167 / 3e-55 Eukaryotic protein of unknown function (DUF872) (.1) Lus10039596 [exp] 56 / 3e-11 AT4G29850 169 / 3e-56 Eukaryotic protein of unknown function (DUF872) (.1) Lus10016385 [exp] 57 / 5e-11 AT4G29850 171 / 2e-55 Eukaryotic protein of unknown function (DUF872) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G053300 [exp] 150 / 2e-48 AT3G29170 132 / 3e-41 Eukaryotic protein of unknown function (DUF872) (.1) Potri.016G054301 [exp] 65 / 9e-15 AT3G29170 47 / 4e-08 Eukaryotic protein of unknown function (DUF872) (.1) Potri.006G072000 [exp] 54 / 2e-10 AT4G29850 176 / 6e-59 Eukaryotic protein of unknown function (DUF872) (.1) Potri.018G133500 [exp] 54 / 2e-10 AT4G29850 154 / 3e-50 Eukaryotic protein of unknown function (DUF872) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05915 [flax] [poplar] DUF872 Eukaryotic protein of unknown function (DUF872)
Representative CDS sequence Show only first row Show all	>Lus10007465 pacid=23176521 polypeptide=Lus10007465 locus=Lus10007465.g ID=Lus10007465.BGIv1.0 annot-version=v1.0 ATGGCGACTAGGCGTCATGTTAATTACAGTCCTATTGCCACTGATGATGATGATGGTTACAATGGTACGAGAAATGACCGTCGCTTCGAGTACACTCCTG GGGCATTCGATAGAATTCCGTGGAAATCCGTCATACTTGCAATCTTCTTACTCTTCCTTGGATCGGTGCTTCTTTTCCTGTCTTTCTTCGTTTTCACGGG CCACATGGGAGGAGAGAAGTCACAAGCTTATGGTCTCTTAGCCTTGGGATTCCTTACCTTCTTACCAGGTTTCTACGAAACTCGGTTAGCATATTACTCA TGGAGGGGTGCCAAGGGCTACCGGTTTGCTTCCATCCCGGATTATTAA
AA sequence Show only first row Show all	>Lus10007465 pacid=23176521 polypeptide=Lus10007465 locus=Lus10007465.g ID=Lus10007465.BGIv1.0 annot-version=v1.0 MATRRHVNYSPIATDDDDGYNGTRNDRRFEYTPGAFDRIPWKSVILAIFLLFLGSVLLFLSFFVFTGHMGGEKSQAYGLLALGFLTFLPGFYETRLAYYS WRGAKGYRFASIPDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G29170			Eukaryotic protein of unknown ...		Lus10007465 [exp]	0	1
AT3G58680		MBF1B, ATMBF1B	multiprotein bridging factor 1...		Lus10013686 [exp]	3.2	0.9042
AT1G34780		ATAPRL4	APR-like 4 (.1.2)		Lus10010354 [exp]	13.0	0.8600
AT4G02350		SEC15B	exocyst complex component sec1...		Lus10010296 [exp]	13.9	0.8689
AT1G63830			PLAC8 family protein (.1.2.3)		Lus10017509 [exp]	14.1	0.9010
AT3G20890			RNA-binding (RRM/RBD/RNP motif...		Lus10009943 [exp]	14.3	0.8626
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Lus10028823 [exp]	16.4	0.8727
AT1G25420			Regulator of Vps4 activity in ...		Lus10041442 [exp]	21.7	0.8824
AT1G08830		CSD1	copper/zinc superoxide dismuta...		Lus10004139 [exp]	22.2	0.8897
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Lus10036023 [exp]	23.0	0.8932
AT5G47870		RAD52-2B, RAD52...	radiation sensitive 51-2, unkn...		Lus10002565 [exp]	26.4	0.8839

Compare expression of checked genes

Lus10007465 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.