Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16566 52 / 4e-10 HINT4 histidine triad nucleotide-binding 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028941 [exp] 104 / 7e-28 AT4G16563 489 / 2e-169 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G076400 [exp] 64 / 2e-14 AT4G16566 210 / 3e-71 histidine triad nucleotide-binding 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007467 pacid=23176479 polypeptide=Lus10007467 locus=Lus10007467.g ID=Lus10007467.BGIv1.0 annot-version=v1.0 ATGATAGATGGCAGCTTAGTTGGGAGGGAGATGGCCGGAGCTTCGTCGCCGTCGCCTTGCATCTTTTGTCAAATCTCTGGGAAATCCACTTCCACCAATC TTCTACATACTGACAATAGAGTAGTGGCTTTCCAGGACATCAGGCCTTCTGCTTTCAGATGGAAGCACATAAAATACCTATCGCTTGGACCACTTGGATT CATCGAAGCTGAAAGATTGCTGGAGAAGATAAAGCCTTGA
AA sequence Show only first row Show all	>Lus10007467 pacid=23176479 polypeptide=Lus10007467 locus=Lus10007467.g ID=Lus10007467.BGIv1.0 annot-version=v1.0 MIDGSLVGREMAGASSPSPCIFCQISGKSTSTNLLHTDNRVVAFQDIRPSAFRWKHIKYLSLGPLGFIEAERLLEKIKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16566		HINT4	histidine triad nucleotide-bin...		Lus10007467 [exp]	0	1
AT5G40350	MYB	ATMYB24	myb domain protein 24 (.1)		Lus10014557 [exp]	6.3	0.8083
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Lus10032324 [exp]	7.4	0.7967
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10024050 [exp]	9.2	0.8044
AT4G20820			FAD-binding Berberine family p...		Lus10023376 [exp]	11.5	0.7987
AT1G60830			RNA-binding (RRM/RBD/RNP motif...		Lus10011201 [exp]	11.7	0.7616
AT1G53830		ATPME2	pectin methylesterase 2 (.1)		Lus10027556 [exp]	13.1	0.7975
AT1G55790			Domain of unknown function (DU...		Lus10032899 [exp]	13.4	0.7549
AT4G29820		CFIM-25, ATCFIM...	ARABIDOPSIS THALIANA HOMOLOG O...		Lus10011944 [exp]	15.9	0.7954
					Lus10006919 [exp]	16.7	0.7929
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10014637 [exp]	19.6	0.7883

Compare expression of checked genes

Lus10007467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.