Lus10007476 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47460 187 / 1e-55 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G16835 147 / 3e-40 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 142 / 2e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G03880 137 / 1e-36 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G27610 137 / 1e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G37380 137 / 1e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G53360 135 / 4e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 135 / 4e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G24000 135 / 7e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G33170 135 / 1e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028953 392 / 7e-135 AT5G47460 541 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014956 143 / 4e-40 AT5G13230 484 / 1e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020918 142 / 8e-39 AT2G29760 474 / 3e-159 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010998 142 / 2e-38 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040577 138 / 2e-38 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030908 141 / 6e-38 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10009269 140 / 6e-38 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030053 140 / 8e-38 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022702 139 / 9e-38 AT3G11460 641 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G136200 141 / 5e-38 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.003G081700 140 / 9e-38 AT4G16835 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G121400 137 / 4e-37 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G217900 138 / 5e-37 AT2G22410 530 / 0.0 SLOW GROWTH 1 (.1)
Potri.005G006400 138 / 5e-37 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G155100 138 / 5e-37 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G086100 137 / 6e-37 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G058900 138 / 9e-37 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G164900 137 / 1e-36 AT5G13230 950 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G111300 136 / 4e-36 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10007476 pacid=23176511 polypeptide=Lus10007476 locus=Lus10007476.g ID=Lus10007476.BGIv1.0 annot-version=v1.0
ATGGCGGTGAAATCTCGAGGACGAGGAGTAGCCTCCGAGTTGGCCACCGAGTTGTTTTATGGATTTGAACCATTTGGACCCTGTTTCCGAACCGGTTTGC
CAAAAGCGATTACTCGTATGTTTTACGGCTGCGTTGAGATGGGGAACGGTTATCCACTATTGCATCGTAAGACGTGGTCTCTCAACAAGAGTGGTTGTCG
GGAGTTCTATGATTACATGTACGCTAAATGCGGTGAAGTTAGTAACGCTGATTCGATATTCCGATCGTTGCCACATAAGAATTTGGTTACGTGGAACGCG
ATCATAGCAGGATACGCTCAGGGCGGGGATTCGGAAAAGGTGATACAATTGTTTGAGGAGTTGAAGAAGGCGAAGGGTCTGCATCCCGATTGGATCACAT
ATCTAAACGTGTTAGCTTCATGCTCGAACGCTAGAGTGCCACTCGAGACAGCAACTCGATATTTCGAATCGATGATCAACGATCACGGAATCATACCATC
CCCCGAGCACTGCTGTTCGATGATTCGTCTCCTGGGACAAAATGGAGAGGTTCGTTCTACTTTGAGGATGATTTACGACTTTAGATTCGAGTCGTGCGGA
GTGGTTTGGAGGGCGTTGCTTGGAGCTTGCGGAACATGTGCGAATTCGCGGGTTGCTAAGATTGCAGCTGCAAAAGTGATTGAACTGGAAGGTGACGATG
ATTATGTTTATGTAATGCTGTCCAGTATTTTTGCATCTTGTGGCAAATGGGGAGATGTAAAGAAGGCGAGGAATCTCATGTGA
AA sequence
>Lus10007476 pacid=23176511 polypeptide=Lus10007476 locus=Lus10007476.g ID=Lus10007476.BGIv1.0 annot-version=v1.0
MAVKSRGRGVASELATELFYGFEPFGPCFRTGLPKAITRMFYGCVEMGNGYPLLHRKTWSLNKSGCREFYDYMYAKCGEVSNADSIFRSLPHKNLVTWNA
IIAGYAQGGDSEKVIQLFEELKKAKGLHPDWITYLNVLASCSNARVPLETATRYFESMINDHGIIPSPEHCCSMIRLLGQNGEVRSTLRMIYDFRFESCG
VVWRALLGACGTCANSRVAKIAAAKVIELEGDDDYVYVMLSSIFASCGKWGDVKKARNLM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G47460 Pentatricopeptide repeat (PPR)... Lus10007476 0 1
AT5G59600 Tetratricopeptide repeat (TPR)... Lus10016511 4.1 0.7862
AT2G43770 Transducin/WD40 repeat-like su... Lus10002211 5.5 0.7743
AT5G47460 Pentatricopeptide repeat (PPR)... Lus10028953 9.2 0.7521
AT1G13410 Tetratricopeptide repeat (TPR)... Lus10021068 11.5 0.7592
AT5G08305 Pentatricopeptide repeat (PPR)... Lus10010183 18.7 0.7276
AT1G07780 TRP6, PAI1 TRANSIENT RECEPTOR POTENTIAL 6... Lus10028971 19.2 0.7243
AT1G13410 Tetratricopeptide repeat (TPR)... Lus10021069 22.4 0.7400
AT3G05640 Protein phosphatase 2C family ... Lus10020671 23.2 0.7129
AT3G46790 CRR2 CHLORORESPIRATORY REDUCTION 2,... Lus10001557 24.0 0.6822
AT2G41080 Tetratricopeptide repeat (TPR)... Lus10003324 31.5 0.7210

Lus10007476 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.