Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17310 66 / 1e-15 unknown protein AT5G47455 50 / 4e-09 unknown protein AT5G11630 42 / 4e-06 unknown protein AT1G70350 37 / 0.0003 unknown protein AT1G55205 37 / 0.0004 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028954 [exp] 84 / 3e-22 AT4G17310 100 / 5e-29 unknown protein Lus10023655 [exp] 43 / 1e-06 AT1G55205 83 / 3e-22 unknown protein Lus10024700 [exp] 43 / 5e-06 AT1G55205 80 / 4e-20 unknown protein Lus10032319 [exp] 43 / 5e-06 AT1G55205 75 / 5e-18 unknown protein Lus10002035 [exp] 40 / 3e-05 AT5G11630 80 / 3e-21 unknown protein Lus10011623 [exp] 39 / 3e-05 AT5G11630 82 / 2e-22 unknown protein Lus10029157 [exp] 36 / 0.0008 AT1G70350 59 / 2e-12 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G068600 [exp] 64 / 8e-15 AT4G17310 94 / 2e-26 unknown protein Potri.001G333800 [exp] 48 / 2e-08 AT5G47455 54 / 1e-10 unknown protein Potri.006G237800 [exp] 42 / 3e-06 AT5G11630 99 / 8e-29 unknown protein Potri.018G082800 [exp] 38 / 0.0001 AT3G13674 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007477 pacid=23176510 polypeptide=Lus10007477 locus=Lus10007477.g ID=Lus10007477.BGIv1.0 annot-version=v1.0 ATGGCATCCTTCGGCGCCAAATTCATATCCAGATCATCCTTATCCTCCATCAAATCCGCCCTCAGATCCAACGCTTCCAAATCTGCCTTCTCCAGATCAG CCACTCCATCCTCCGCTCCCTCCGTCCGCCGCTTCTCCAGGATGCCGTCGGAGCTGGGATGCGCGGCGTCTCTGCTGCCGCTGCACAGTGCGGTGGCGAC GGCGAGGCTGACGTCATGCTTGAGCACCACTTCGATTAGCTGCCGTGCGCTCTCTCAGGGTACACTCTGCTGCACCTCTCCCAGCCTCTAA
AA sequence Show only first row Show all	>Lus10007477 pacid=23176510 polypeptide=Lus10007477 locus=Lus10007477.g ID=Lus10007477.BGIv1.0 annot-version=v1.0 MASFGAKFISRSSLSSIKSALRSNASKSAFSRSATPSSAPSVRRFSRMPSELGCAASLLPLHSAVATARLTSCLSTTSISCRALSQGTLCCTSPSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17310			unknown protein		Lus10007477 [exp]	0	1
AT3G27080		TOM20-3	translocase of outer membrane ...		Lus10011363 [exp]	2.4	0.7415
AT3G22330		ATRH53, PMH2	putative mitochondrial RNA hel...		Lus10031012 [exp]	8.9	0.7826
AT3G22330		ATRH53, PMH2	putative mitochondrial RNA hel...		Lus10035410 [exp]	20.2	0.7539
AT3G18600			P-loop containing nucleoside t...		Lus10038950 [exp]	23.0	0.7601
AT3G18600			P-loop containing nucleoside t...		Lus10027240 [exp]	23.4	0.7661
AT4G17310			unknown protein		Lus10028954 [exp]	23.4	0.6302
AT3G18580			Nucleic acid-binding, OB-fold-...		Lus10027237 [exp]	24.1	0.7609
AT5G52220			unknown protein		Lus10014990 [exp]	44.6	0.6472
AT3G23710		AtTic22-III	translocon at the inner envelo...		Lus10007784 [exp]	53.7	0.6530
AT3G14890			phosphoesterase (.1.2)		Lus10037922 [exp]	66.1	0.6785

Compare expression of checked genes

Lus10007477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.