Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65660 89 / 6e-22 SMP1 SWELLMAP 1, Pre-mRNA splicing Prp18-interacting factor (.1) AT4G37120 81 / 4e-19 SMP2 SWELLMAP 2, Pre-mRNA splicing Prp18-interacting factor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028956 [exp] 118 / 1e-32 AT1G65660 891 / 0.0 SWELLMAP 1, Pre-mRNA splicing Prp18-interacting factor (.1) Lus10024887 [exp] 116 / 7e-32 AT1G65660 895 / 0.0 SWELLMAP 1, Pre-mRNA splicing Prp18-interacting factor (.1) Lus10022931 [exp] 116 / 7e-32 AT1G65660 895 / 0.0 SWELLMAP 1, Pre-mRNA splicing Prp18-interacting factor (.1) Lus10030817 [exp] 110 / 2e-29 AT1G70060 1426 / 0.0 SIN3-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G064100 [exp] 108 / 4e-29 AT1G65660 801 / 0.0 SWELLMAP 1, Pre-mRNA splicing Prp18-interacting factor (.1) Potri.015G048200 [exp] 107 / 2e-28 AT1G65660 830 / 0.0 SWELLMAP 1, Pre-mRNA splicing Prp18-interacting factor (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007479 pacid=23176477 polypeptide=Lus10007479 locus=Lus10007480.g ID=Lus10007479.BGIv1.0 annot-version=v1.0 ATGAAAGAAAATATCGCGCGGAAAGAAGCTGATGACGACGTCCCAGAACCCGTAGAGGAGAAAAGGCTCGCGACATGGGGTTCCGAGGTACCCGACGATC GGGTGCTGGATGAGAAGCTACTAGCTGAATCGCTGAAGAAGGAAGACCAGAGGAAGAACGAGGAGAAGGACGAGAGGAAACGCAAGTACAATGTGAAGTG GAATGATCAGGTTACTGTGGAGGACATGGAGGCATGTCGGATGAAGAAAGTGCATCATGATGATCCAATGAAGGATTTGCTTAACTGA
AA sequence Show only first row Show all	>Lus10007479 pacid=23176477 polypeptide=Lus10007479 locus=Lus10007480.g ID=Lus10007479.BGIv1.0 annot-version=v1.0 MKENIARKEADDDVPEPVEEKRLATWGSEVPDDRVLDEKLLAESLKKEDQRKNEEKDERKRKYNVKWNDQVTVEDMEACRMKKVHHDDPMKDLLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	0	1
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011717 [exp]	1.4	0.9132
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	1.4	0.9162
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10010386 [exp]	1.7	0.9112
AT5G48580		FKBP15-2	FK506- and rapamycin-binding p...		Lus10035800 [exp]	2.0	0.8935
AT5G62810		ATPEX14, PED2, ...	PEROXISOME DEFECTIVE 2, peroxi...		Lus10039935 [exp]	4.9	0.8885
AT2G39260			binding;RNA binding (.1)		Lus10030801 [exp]	5.0	0.8891
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10034952 [exp]	5.7	0.8696
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Lus10010371 [exp]	6.9	0.8417
AT5G55500		ATXYLT	"beta-1,2-xylosyltransferase",...		Lus10014902 [exp]	7.0	0.8705
AT3G03980			NAD(P)-binding Rossmann-fold s...		Lus10002628 [exp]	7.1	0.8517

Compare expression of checked genes

Lus10007479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.