Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17360 98 / 2e-26 Formyl transferase (.1) AT5G47435 96 / 7e-26 formyltetrahydrofolate deformylase, putative (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028958 [exp] 103 / 9e-29 AT5G47435 498 / 3e-179 formyltetrahydrofolate deformylase, putative (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G156600 [exp] 98 / 1e-26 AT5G47435 476 / 2e-170 formyltetrahydrofolate deformylase, putative (.1.2) Potri.003G078000 [exp] 96 / 5e-26 AT5G47435 484 / 7e-174 formyltetrahydrofolate deformylase, putative (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00551 [flax] [poplar] Formyl_trans_N Formyl transferase
Representative CDS sequence Show only first row Show all	>Lus10007482 pacid=23176497 polypeptide=Lus10007482 locus=Lus10007482.g ID=Lus10007482.BGIv1.0 annot-version=v1.0 ATGCAGGCTTTTGATGCAGGCGTAAAACTGATTGGAGCAACATCTCATTTTGTCACTGAAGAGCTTGATTCTGGGCCAATTATTGAACAGATGGTGGAGA GAGTTACCCACGGGGATAATCTACGAAGTTGCATCCAGAAATCGGAGAACCTAGAGAAACAAGAAAGCTATAAAGTCCGACTGTGA
AA sequence Show only first row Show all	>Lus10007482 pacid=23176497 polypeptide=Lus10007482 locus=Lus10007482.g ID=Lus10007482.BGIv1.0 annot-version=v1.0 MQAFDAGVKLIGATSHFVTEELDSGPIIEQMVERVTHGDNLRSCIQKSENLEKQESYKVRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17360			Formyl transferase (.1)		Lus10007482 [exp]	0	1
AT5G17060		ATARFB1B	ADP-ribosylation factor B1B (....		Lus10009571 [exp]	6.2	0.8222
AT1G77000		ATSKP2;2, SKP2B	ARABIDOPSIS HOMOLOG OF HOMOLOG...		Lus10000776 [exp]	9.3	0.8165
AT4G26965			NADH:ubiquinone oxidoreductase...		Lus10032642 [exp]	14.7	0.7882
AT4G17250			unknown protein		Lus10008508 [exp]	15.0	0.7921
AT3G45020			Ribosomal L18p/L5e family prot...		Lus10021433 [exp]	18.3	0.8037
AT3G26922			F-box/RNI-like superfamily pro...		Lus10016192 [exp]	19.9	0.7104
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10019084 [exp]	21.4	0.7898
AT4G22590		TPPG	trehalose-6-phosphate phosphat...		Lus10024607 [exp]	29.3	0.7485
AT4G00420			Double-stranded RNA-binding do...		Lus10024106 [exp]	29.4	0.7455
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10023923 [exp]	31.5	0.7980

Compare expression of checked genes

Lus10007482 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.