Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41473 45 / 2e-07 F-box family protein (.1) AT3G16210 45 / 7e-07 F-box family protein (.1) AT1G47765 39 / 0.0001 F-box and associated interaction domains-containing protein (.1) AT3G23880 39 / 0.0002 F-box and associated interaction domains-containing protein (.1) AT1G47790 39 / 0.0002 F-box and associated interaction domains-containing protein (.1) AT2G16220 39 / 0.0003 F-box and associated interaction domains-containing protein (.1) AT3G17480 38 / 0.0003 F-box and associated interaction domains-containing protein (.1) AT3G21120 38 / 0.0004 F-box and associated interaction domains-containing protein (.1) AT3G07870 37 / 0.0005 F-box and associated interaction domains-containing protein (.1) AT1G47300 37 / 0.0008 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028961 [exp] 115 / 1e-31 AT4G12560 81 / 2e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10015408 [exp] 85 / 1e-20 AT3G16210 64 / 6e-11 F-box family protein (.1) Lus10023372 [exp] 81 / 2e-19 AT3G16210 67 / 5e-12 F-box family protein (.1) Lus10001105 [exp] 72 / 6e-16 AT3G06240 109 / 3e-26 F-box family protein (.1) Lus10018008 [exp] 62 / 2e-12 AT3G16210 82 / 6e-17 F-box family protein (.1) Lus10014937 [exp] 52 / 4e-09 AT3G06240 79 / 4e-16 F-box family protein (.1) Lus10029725 [exp] 52 / 7e-09 AT3G06240 74 / 3e-14 F-box family protein (.1) Lus10027780 [exp] 50 / 2e-08 AT3G23880 60 / 6e-10 F-box and associated interaction domains-containing protein (.1) Lus10014935 [exp] 50 / 2e-08 AT3G06240 84 / 2e-17 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G058000 [exp] 44 / 2e-06 AT3G06240 138 / 5e-37 F-box family protein (.1) Potri.011G037312 [exp] 44 / 3e-06 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1) Potri.011G037200 [exp] 44 / 3e-06 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1) Potri.006G170300 [exp] 44 / 3e-06 AT4G12560 69 / 1e-12 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G458400 [exp] 44 / 4e-06 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1) Potri.001G318400 [exp] 43 / 5e-06 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.003G145950 [exp] 42 / 1e-05 AT4G12560 113 / 7e-28 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.005G114900 [exp] 42 / 1e-05 AT3G21410 73 / 9e-14 F-box and associated interaction domains-containing protein (.1) Potri.014G162600 [exp] 42 / 2e-05 AT3G07870 467 / 9e-164 F-box and associated interaction domains-containing protein (.1) Potri.002G223000 [exp] 41 / 3e-05 AT3G07870 467 / 5e-164 F-box and associated interaction domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10007486 pacid=23176486 polypeptide=Lus10007486 locus=Lus10007486.g ID=Lus10007486.BGIv1.0 annot-version=v1.0 ATGGCCGCCGGCGGAAACAACAACCAGAATGCCGACCAAGCATTCTTCCTGACGGAAGATATCGTGATGAACATCCTCCTGAGGCTGCCGATCGCTCTAT ACATAGCTCGATTCCGGTGCGTGTGCAGATCCTGGCGAAATCTCCTCTCCGATCCCAATGTCATTCGCAAAATTCTCTTCTTCCAAAATCTCGTCGAGAC GATCGAGGAGCCGATGAGTCTCTTCTCCGGTACGATTCCATACTCCTTATACTCCTACGACACACTCACTCCGATCGAACCTCCGCGCTGA
AA sequence Show only first row Show all	>Lus10007486 pacid=23176486 polypeptide=Lus10007486 locus=Lus10007486.g ID=Lus10007486.BGIv1.0 annot-version=v1.0 MAAGGNNNQNADQAFFLTEDIVMNILLRLPIALYIARFRCVCRSWRNLLSDPNVIRKILFFQNLVETIEEPMSLFSGTIPYSLYSYDTLTPIEPPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41473			F-box family protein (.1)		Lus10007486 [exp]	0	1
AT4G09160			SEC14 cytosolic factor family ...		Lus10025540 [exp]	3.7	0.6201
AT3G22490			Seed maturation protein (.1)		Lus10010553 [exp]	106.2	0.5727
					Lus10032106 [exp]	171.6	0.5409
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10000678 [exp]	196.8	0.5458

Compare expression of checked genes

Lus10007486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.