Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16695 86 / 1e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028968 [exp] 105 / 3e-32 AT4G16695 86 / 1e-24 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G078100 [exp] 93 / 2e-27 AT4G16695 89 / 1e-25 unknown protein Potri.001G156500 [exp] 88 / 2e-25 AT4G16695 83 / 2e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007491 pacid=23176507 polypeptide=Lus10007491 locus=Lus10007491.g ID=Lus10007491.BGIv1.0 annot-version=v1.0 ATGCCTCATCTTAGAATCGTCGAGGTTGAGCCACCTAGTCCGATCAGATACCTCATCGGCGCGGCGATTATGATGATCGGAGTGGTATTTCCGGTCGGAT ACATGATGTTCCGCAACAAGCGAGTCCCTTCTTCTTCTTCTTACTCCAAACAGACGTAG
AA sequence Show only first row Show all	>Lus10007491 pacid=23176507 polypeptide=Lus10007491 locus=Lus10007491.g ID=Lus10007491.BGIv1.0 annot-version=v1.0 MPHLRIVEVEPPSPIRYLIGAAIMMIGVVFPVGYMMFRNKRVPSSSSYSKQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16695			unknown protein		Lus10007491 [exp]	0	1
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10024418 [exp]	2.6	0.8456
AT3G51040		RTH	RTE1-homolog (.1.2.3)		Lus10028350 [exp]	7.7	0.8047
AT3G01690			alpha/beta-Hydrolases superfam...		Lus10000544 [exp]	10.5	0.7647
AT5G58000			Reticulon family protein (.1)		Lus10035829 [exp]	17.5	0.8201
AT5G64020		TBL14	TRICHOME BIREFRINGENCE-LIKE 14...		Lus10037877 [exp]	25.3	0.7745
AT4G39220		ATRER1A	Rer1 family protein (.1)		Lus10011502 [exp]	25.4	0.8111
AT5G17190			unknown protein		Lus10031957 [exp]	27.4	0.7718
AT4G32530			ATPase, F0/V0 complex, subunit...		Lus10000694 [exp]	29.7	0.7687
AT3G22950		ATARFC1	ADP-ribosylation factor C1 (.1...		Lus10006632 [exp]	29.8	0.7451
AT4G29340		PRF4	profilin 4 (.1)		Lus10034988 [exp]	32.2	0.7853

Compare expression of checked genes

Lus10007491 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.