Lus10007504 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21945 42 / 4e-05 Receptor-like protein kinase-related family protein (.1)
AT4G28670 42 / 6e-05 Protein kinase family protein with domain of unknown function (DUF26) (.1)
AT3G21940 41 / 0.0002 Receptor protein kinase-related (.1)
AT3G22040 41 / 0.0002 Domain of unknown function (DUF26) (.1)
AT5G48540 40 / 0.0003 receptor-like protein kinase-related family protein (.1)
AT1G70520 40 / 0.0004 ASG6, CRK2 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1)
AT3G60720 40 / 0.0005 PDLP8 plasmodesmata-located protein 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028980 219 / 2e-73 AT3G21945 39 / 9e-04 Receptor-like protein kinase-related family protein (.1)
Lus10040943 154 / 2e-48 AT4G23180 39 / 9e-04 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10009833 152 / 7e-48 AT4G23180 39 / 7e-04 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10011438 53 / 2e-09 ND 35 / 0.004
Lus10012623 52 / 5e-09 ND 38 / 0.001
Lus10015472 52 / 9e-09 AT5G48540 42 / 4e-05 receptor-like protein kinase-related family protein (.1)
Lus10028026 50 / 5e-08 AT4G23290 44 / 1e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2)
Lus10026810 50 / 7e-08 AT1G63600 41 / 1e-04 Receptor-like protein kinase-related family protein (.1)
Lus10033389 49 / 7e-08 AT1G19090 44 / 2e-05 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 1, receptor-like serine/threonine kinase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 56 / 3e-10 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.002G249600 40 / 0.0002 AT5G48540 256 / 7e-86 receptor-like protein kinase-related family protein (.1)
Potri.004G026200 40 / 0.0003 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.007G120600 40 / 0.0003 AT3G22060 214 / 2e-69 Receptor-like protein kinase-related family protein (.1)
Potri.011G027600 40 / 0.0004 AT4G23280 461 / 3e-156 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1)
Potri.011G030650 40 / 0.0006 AT4G05200 476 / 1e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G024900 40 / 0.0006 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025900 40 / 0.0006 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.004G025425 39 / 0.0007 AT4G21410 556 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.011G027900 39 / 0.0008 AT4G23180 542 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10007504 pacid=23176515 polypeptide=Lus10007504 locus=Lus10007504.g ID=Lus10007504.BGIv1.0 annot-version=v1.0
ATGGCTCGCCTAGTGATGTTTGCCTTAGCCGCTACCGTCCTCGGATTACTAGCCACCGGCACCAACTCAACATCTCCATCTCCATCTCCATCTCCATCTC
CATCGCCATTGCGAGCTCCATCTCCATCGCGGTCGCCTTCGAAATCACACTCTTCACACTCATCATCGCCGTCGCTCTCGCCGCTGCCTGCGGCGGCGGG
AGTGGTGTGCAATGAGACGAGTTACACGAACGTGTACCCGATAGACAACTACGTGAAGCACGTGCTGGAGGAGCTGGGCGACGAAGTGAGCAACAGCAAG
GGTTACGCGATGGCTATCAAGTTTCCGGAAATAGACAGGCCGATTATGATGGGACAGGGAGCCTGTACTAGGAACATGTCGGCGGCGGATTGCTCCGGCT
GTCTTAAGGACGGGGCGAAGAAGGTAATTGCAGGGTGCCCTCACAAAGTTGGTGCTCGGTTCAACGCCACCGGGTGCAAATTACGGTACGACGTTTATCA
GGATGTCGTCTAA
AA sequence
>Lus10007504 pacid=23176515 polypeptide=Lus10007504 locus=Lus10007504.g ID=Lus10007504.BGIv1.0 annot-version=v1.0
MARLVMFALAATVLGLLATGTNSTSPSPSPSPSPSPLRAPSPSRSPSKSHSSHSSSPSLSPLPAAAGVVCNETSYTNVYPIDNYVKHVLEELGDEVSNSK
GYAMAIKFPEIDRPIMMGQGACTRNMSAADCSGCLKDGAKKVIAGCPHKVGARFNATGCKLRYDVYQDVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22040 Domain of unknown function (DU... Lus10007504 0 1
AT4G28530 NAC ANAC074 NAC domain containing protein ... Lus10024908 1.7 0.7894
Lus10021186 16.1 0.6839
AT5G52210 ATGB1, ATARLB1 GTP-binding protein 1 (.1.2) Lus10038871 17.2 0.6686
AT5G53310 myosin heavy chain-related (.1... Lus10039322 20.7 0.6765
AT5G42930 alpha/beta-Hydrolases superfam... Lus10009361 23.5 0.6746
AT3G28345 MDR13, ABCB15 multi-drug resistance 13, ATP-... Lus10024162 23.5 0.7206
AT5G12000 Protein kinase protein with ad... Lus10006021 23.9 0.7099
AT1G51200 A20/AN1-like zinc finger famil... Lus10031833 28.5 0.7051
AT3G50910 unknown protein Lus10025996 49.7 0.6609
AT1G34420 leucine-rich repeat transmembr... Lus10009429 50.5 0.6585

Lus10007504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.