Lus10007506 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22040 39 / 0.0004 Domain of unknown function (DUF26) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007505 157 / 4e-49 ND 39 / 0.002
Lus10042124 66 / 2e-13 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1)
Lus10002371 62 / 5e-13 AT4G38830 37 / 0.001 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
Lus10007508 54 / 2e-10 ND /
Lus10011040 49 / 3e-08 AT3G21940 38 / 8e-04 Receptor protein kinase-related (.1)
Lus10028981 48 / 2e-07 ND 35 / 0.007
Lus10007507 47 / 4e-07 ND /
Lus10018377 42 / 5e-05 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10010960 42 / 7e-05 AT1G70520 373 / 2e-121 ALTERED SEED GERMINATION 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G024900 45 / 3e-06 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025900 45 / 4e-06 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.004G026000 42 / 4e-05 AT4G05200 353 / 3e-116 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G025001 42 / 4e-05 AT4G05200 465 / 4e-158 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.011G028400 40 / 0.0002 AT4G05200 709 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.011G028100 40 / 0.0004 AT4G05200 519 / 8e-177 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G026200 39 / 0.0005 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.011G028500 39 / 0.0005 AT4G05200 160 / 4e-44 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G025425 39 / 0.0007 AT4G21410 556 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.007G120401 39 / 0.0007 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10007506 pacid=23176523 polypeptide=Lus10007506 locus=Lus10007506.g ID=Lus10007506.BGIv1.0 annot-version=v1.0
ATGAAGATAGCAAAGTTGACATCAATAGCACTATTCGTGGGATCGATTATCACTATCGGCTTGCGTATGCATCCAGCTGGTTACGAAAAAGATGACGTCG
TCGTCACTGACCAATCGGGAGGTTTCCAGTACTTTTGGAACACTACGAACTTCCACGACCCGGTCCTGCACTACTGCACGGCGCTTTTCAACGAGATGCT
CAAGGGTGGCGAGTTTCTGCAGAGCGCGCGCTTTCTGGACAATGTGATAACATGTCCCGACTATTACTTACCGCCGAATCTTTATACGATGGTGCATTGT
CGCGACCGGGGCGAATGCAATCAGTGTCTCGAGAATGCTGCTTCATTGATGGACCAATGTTGCGTCGACTGTTACGGATTTCGCGCGTTGAGTGATGATT
GTTGGGTGCGATATGAGACTTACAGCTTCTCGTCGTATAACTAG
AA sequence
>Lus10007506 pacid=23176523 polypeptide=Lus10007506 locus=Lus10007506.g ID=Lus10007506.BGIv1.0 annot-version=v1.0
MKIAKLTSIALFVGSIITIGLRMHPAGYEKDDVVVTDQSGGFQYFWNTTNFHDPVLHYCTALFNEMLKGGEFLQSARFLDNVITCPDYYLPPNLYTMVHC
RDRGECNQCLENAASLMDQCCVDCYGFRALSDDCWVRYETYSFSSYN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22040 Domain of unknown function (DU... Lus10007506 0 1
AT3G43660 Vacuolar iron transporter (VIT... Lus10015135 1.0 0.8158
AT2G39530 Uncharacterised protein family... Lus10031305 6.2 0.7167
Lus10000914 7.5 0.7167
AT3G04290 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) Lus10036966 8.9 0.7091
AT4G25350 SHB1 SHORT HYPOCOTYL UNDER BLUE1, E... Lus10037146 10.5 0.7020
AT5G59700 Protein kinase superfamily pro... Lus10023324 14.1 0.6352
AT2G38890 unknown protein Lus10023488 18.2 0.6565
AT3G11680 Aluminium activated malate tra... Lus10013577 22.8 0.5908
AT2G31960 ATGSL3, ATGSL03 glucan synthase-like 3 (.1.2) Lus10003917 23.4 0.6413
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10004578 29.8 0.5988

Lus10007506 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.