Lus10007507 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028981 133 / 1e-40 ND 35 / 0.007
Lus10028982 125 / 6e-37 ND /
Lus10007508 105 / 2e-30 ND /
Lus10002371 52 / 4e-09 AT4G38830 37 / 0.001 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
Lus10042124 53 / 8e-09 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1)
Lus10007506 47 / 3e-07 AT3G22040 39 / 5e-04 Domain of unknown function (DUF26) (.1)
Lus10007505 48 / 4e-07 ND 39 / 0.002
Lus10022828 45 / 2e-06 AT2G01660 43 / 2e-05 plasmodesmata-located protein 6 (.1.2)
Lus10011894 43 / 1e-05 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10007507 pacid=23176519 polypeptide=Lus10007507 locus=Lus10007507.g ID=Lus10007507.BGIv1.0 annot-version=v1.0
ATGGCTGGAAGACGGTTGGAGCTCTCAACAACGACAACGGCAGACGTTGGGTTCATCATCATCATCGCCGTCGCGCTGTTTGGGATACGAGGCAAGGCCG
AATACGACAAAGGTTTCGAATACCGATGTAATCTGACCAGGTTCAACCCGGTGAGAGACAGGGTAATGTATCAAGCTGTCTTGACATTTACCTACTTGGT
TGCGGATCGTACGACGTACGTTGACCAACCGGGGAACCGAGACGGTTTAATCGCTTACGGTTCGGGTGAGAGGTGGATCTACACTTGGGTCCACTGTGGA
TCTTATATAGCGTGCCCAGACTGTCTCCAGGCTGCTGCATCGATCGCGAAGGAATCTTTTACTCATTCATACGGAGTTGATGTCATCAATAACGACTGCG
AGATTCGGTACGAGACTTACCAATTTTAG
AA sequence
>Lus10007507 pacid=23176519 polypeptide=Lus10007507 locus=Lus10007507.g ID=Lus10007507.BGIv1.0 annot-version=v1.0
MAGRRLELSTTTTADVGFIIIIAVALFGIRGKAEYDKGFEYRCNLTRFNPVRDRVMYQAVLTFTYLVADRTTYVDQPGNRDGLIAYGSGERWIYTWVHCG
SYIACPDCLQAAASIAKESFTHSYGVDVINNDCEIRYETYQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007507 0 1
AT5G62850 ATVEX1, SWEET5,... VEGETATIVE CELL EXPRESSED1, No... Lus10002364 4.7 0.9577
AT2G36780 UDP-Glycosyltransferase superf... Lus10023894 7.8 0.8704
AT1G30050 unknown protein Lus10035609 10.4 0.9389
AT3G03080 Zinc-binding dehydrogenase fam... Lus10003638 12.6 0.9380
Lus10005830 15.7 0.9303
AT2G32360 Ubiquitin-like superfamily pro... Lus10015125 16.9 0.9260
Lus10009618 17.6 0.9303
AT4G03220 Protein with RNI-like/FBD-like... Lus10023567 19.3 0.9303
AT1G75790 SKS18 SKU5 similar 18 (.1) Lus10013556 20.8 0.9303
AT1G78610 MSL6 mechanosensitive channel of sm... Lus10012516 20.9 0.8404

Lus10007507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.