Lus10007508 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007507 105 / 8e-31 ND /
Lus10028981 103 / 4e-30 ND 35 / 0.007
Lus10028982 81 / 1e-20 ND /
Lus10007505 57 / 1e-11 ND 39 / 0.002
Lus10007506 54 / 1e-10 AT3G22040 39 / 5e-04 Domain of unknown function (DUF26) (.1)
Lus10002371 52 / 2e-10 AT4G38830 37 / 0.001 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
Lus10042124 49 / 3e-08 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1)
Lus10011040 42 / 2e-06 AT3G21940 38 / 8e-04 Receptor protein kinase-related (.1)
Lus10018232 38 / 0.0001 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10007508 pacid=23176484 polypeptide=Lus10007508 locus=Lus10007508.g ID=Lus10007508.BGIv1.0 annot-version=v1.0
ATGACGTACGGTTTCGAACCGAGGAACCGTGACCGGTTAATTGCTTATGGTTCGGGCCAGAGGTTTATCCACACTTGGGTCCATTGTAGTTCTTATGAGA
CGTGCCCGGATTGTCTCCAAGGTGCTGCATCGATGGCGGACCAAAATTGTGCAGACTCTTATGGAGTTGATGTCCAGAATGACGATTGCGAGATTCGGTA
CGAGACTTACCTATTTTAG
AA sequence
>Lus10007508 pacid=23176484 polypeptide=Lus10007508 locus=Lus10007508.g ID=Lus10007508.BGIv1.0 annot-version=v1.0
MTYGFEPRNRDRLIAYGSGQRFIHTWVHCSSYETCPDCLQGAASMADQNCADSYGVDVQNDDCEIRYETYLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007508 0 1
AT1G04670 unknown protein Lus10004041 1.4 1.0000
Lus10006918 2.4 1.0000
AT3G53690 RING/U-box superfamily protein... Lus10042610 3.5 1.0000
AT5G60010 ferric reductase-like transmem... Lus10019390 3.5 1.0000
AT1G22440 Zinc-binding alcohol dehydroge... Lus10009516 5.0 1.0000
AT3G14880 unknown protein Lus10039196 5.1 0.9925
AT1G22440 Zinc-binding alcohol dehydroge... Lus10009517 5.3 0.9914
Lus10027066 5.5 1.0000
Lus10040397 6.3 1.0000
AT1G25270 nodulin MtN21 /EamA-like trans... Lus10015066 6.3 0.9975

Lus10007508 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.