Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007507 [exp] 105 / 8e-31 ND / Lus10028981 [exp] 103 / 4e-30 ND 35 / 0.007 Lus10028982 [exp] 81 / 1e-20 ND / Lus10007505 [exp] 57 / 1e-11 ND 39 / 0.002 Lus10007506 [exp] 54 / 1e-10 AT3G22040 39 / 5e-04 Domain of unknown function (DUF26) (.1) Lus10002371 [exp] 52 / 2e-10 AT4G38830 37 / 0.001 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1) Lus10042124 [exp] 49 / 3e-08 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1) Lus10011040 [exp] 42 / 2e-06 AT3G21940 38 / 8e-04 Receptor protein kinase-related (.1) Lus10018232 [exp] 38 / 0.0001 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10007508 pacid=23176484 polypeptide=Lus10007508 locus=Lus10007508.g ID=Lus10007508.BGIv1.0 annot-version=v1.0 ATGACGTACGGTTTCGAACCGAGGAACCGTGACCGGTTAATTGCTTATGGTTCGGGCCAGAGGTTTATCCACACTTGGGTCCATTGTAGTTCTTATGAGA CGTGCCCGGATTGTCTCCAAGGTGCTGCATCGATGGCGGACCAAAATTGTGCAGACTCTTATGGAGTTGATGTCCAGAATGACGATTGCGAGATTCGGTA CGAGACTTACCTATTTTAG
AA sequence Show only first row Show all	>Lus10007508 pacid=23176484 polypeptide=Lus10007508 locus=Lus10007508.g ID=Lus10007508.BGIv1.0 annot-version=v1.0 MTYGFEPRNRDRLIAYGSGQRFIHTWVHCSSYETCPDCLQGAASMADQNCADSYGVDVQNDDCEIRYETYLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007508 [exp]	0	1
AT1G04670			unknown protein		Lus10004041 [exp]	1.4	1.0000
					Lus10006918 [exp]	2.4	1.0000
AT3G53690			RING/U-box superfamily protein...		Lus10042610 [exp]	3.5	1.0000
AT5G60010			ferric reductase-like transmem...		Lus10019390 [exp]	3.5	1.0000
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009516 [exp]	5.0	1.0000
AT3G14880			unknown protein		Lus10039196 [exp]	5.1	0.9925
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009517 [exp]	5.3	0.9914
					Lus10027066 [exp]	5.5	1.0000
					Lus10040397 [exp]	6.3	1.0000
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10015066 [exp]	6.3	0.9975

Compare expression of checked genes

Lus10007508 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.