Lus10007515 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05500 117 / 2e-33 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1)
AT3G09925 52 / 1e-08 Pollen Ole e 1 allergen and extensin family protein (.1)
AT2G34700 44 / 1e-05 Pollen Ole e 1 allergen and extensin family protein (.1)
AT2G47530 39 / 0.0009 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017440 295 / 2e-103 AT5G05500 128 / 7e-38 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10040948 163 / 2e-51 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10009837 159 / 1e-49 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10015434 59 / 1e-10 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2)
Lus10014013 54 / 4e-09 AT2G34700 137 / 2e-40 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10023887 45 / 7e-06 AT3G09925 167 / 4e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G072000 137 / 4e-41 AT5G05500 152 / 5e-47 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.010G185400 133 / 7e-40 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.011G053600 62 / 7e-12 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.004G044700 56 / 8e-10 AT2G34700 142 / 8e-43 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.006G119100 48 / 6e-07 AT3G09925 180 / 7e-58 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.017G145800 44 / 3e-05 AT4G02270 118 / 5e-33 root hair specific 13 (.1)
Potri.001G326200 42 / 6e-05 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.014G126300 40 / 0.0003 AT2G47540 114 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.017G068400 39 / 0.0004 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.014G126500 40 / 0.0005 AT2G47540 113 / 6e-30 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0287 Transthyretin PF01190 Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence
>Lus10007515 pacid=23176518 polypeptide=Lus10007515 locus=Lus10007515.g ID=Lus10007515.BGIv1.0 annot-version=v1.0
ATGGCAGCCAACAACAACCATCTGATCATAGCTTCAATTTGCTCTCTCATCCTCCTCACAATTACAGCCTTCCCAACATCATCATCAGCAACAACTGAAG
AACATTATGTCCCGATTCCAAAACAGAACATCGTATCAGTCGTGGTAGTCGAAGGGGTCGTCTACTGCCAGAAATGCCAGAATCCTGGCTCCCTGACAGG
TGCTACGCCGATCCCTTACGCCAAAGTCAACGTCAATTGTAGGAATTTGCGACACATGTTGACCTTCCAAAAGGTCTACACTGCGAACCAACACGGCTAC
TTCTTCGCTCAGCTAGATGGCTTCAGGTTAGGCCACGGAATTTTCGACATCCCGCCTCTCCAAGCCTGCAATGTGAAGCTTGTTTCGTCTCCTCTCCGAT
CCTGCAATGTCGCTACGGAGATTAACTCGGGACCTTACGGAGCTACGCTCCGGTCCGAGAACAAGGTGTACAAGTACCCTCCGTACGAGACTGTTATATA
TGCGGCTGGTCCTCTGGCTTTCCGGCCTAGTAATTGTTACTGA
AA sequence
>Lus10007515 pacid=23176518 polypeptide=Lus10007515 locus=Lus10007515.g ID=Lus10007515.BGIv1.0 annot-version=v1.0
MAANNNHLIIASICSLILLTITAFPTSSSATTEEHYVPIPKQNIVSVVVVEGVVYCQKCQNPGSLTGATPIPYAKVNVNCRNLRHMLTFQKVYTANQHGY
FFAQLDGFRLGHGIFDIPPLQACNVKLVSSPLRSCNVATEINSGPYGATLRSENKVYKYPPYETVIYAAGPLAFRPSNCY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10007515 0 1

Lus10007515 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.