Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05480 81 / 8e-19 Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A protein (.1) AT3G14920 39 / 0.0003 Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017437 [exp] 221 / 3e-70 AT5G05480 605 / 0.0 Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G072400 [exp] 116 / 2e-31 AT5G05480 577 / 0.0 Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A protein (.1) Potri.010G185100 [exp] 109 / 8e-29 AT5G05480 601 / 0.0 Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007519 pacid=23176464 polypeptide=Lus10007519 locus=Lus10007519.g ID=Lus10007519.BGIv1.0 annot-version=v1.0 ATGAAGAAAGAGGTTATAGTCACTAACGAATTCAATCAGCTGGTTAGTCGCGTCAAGATCAAACAAAGGTATCCGATCAAAATGTCATCAGCTACGCTCC CCGGATCGAATCCGGATACTTATCTGATGATCACGAATGTTTCTCACGCGTTCTTGGAGAGGTACGTTAATGGCAGAGGAGGTAATAAGAGGAATGTGTA TAACAAACAGGATTCCAATGGATGGATGGAAGTGAAGGATCATGATGTTCTCAATGGAGGTTCGGTTACTAACCAGACTTTGAGTTGCAGGGACGGTGAT GAACTGAGTTGCTTCATTTGGAAGCTTGTGAATAACGACACCTCCTCTGTTTGTCCGTCTGTGTATGTAAACTGA
AA sequence Show only first row Show all	>Lus10007519 pacid=23176464 polypeptide=Lus10007519 locus=Lus10007519.g ID=Lus10007519.BGIv1.0 annot-version=v1.0 MKKEVIVTNEFNQLVSRVKIKQRYPIKMSSATLPGSNPDTYLMITNVSHAFLERYVNGRGGNKRNVYNKQDSNGWMEVKDHDVLNGGSVTNQTLSCRDGD ELSCFIWKLVNNDTSSVCPSVYVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05480			Peptide-N4-(N-acetyl-beta-gluc...		Lus10007519 [exp]	0	1
AT5G05480			Peptide-N4-(N-acetyl-beta-gluc...		Lus10007518 [exp]	14.2	0.5091
AT2G34930			disease resistance family prot...		Lus10016326 [exp]	29.6	0.4249
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004068 [exp]	53.6	0.4038
AT4G23160		CRK8	cysteine-rich RLK (RECEPTOR-li...		Lus10021849 [exp]	61.5	0.3779
					Lus10002077 [exp]	103.0	0.3520
AT5G59120		ATSBT4.13	subtilase 4.13 (.1)		Lus10000434 [exp]	114.1	0.3415

Compare expression of checked genes

Lus10007519 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.