Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30130 181 / 2e-58 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT1G31320 152 / 3e-47 AS2 LBD4 LOB domain-containing protein 4 (.1) AT1G07900 145 / 2e-44 AS2 LBD1 LOB domain-containing protein 1 (.1) AT2G28500 145 / 5e-44 AS2 LBD11 LOB domain-containing protein 11 (.1) AT5G63090 143 / 2e-43 AS2 LOBB, LOB Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT1G16530 142 / 2e-43 AS2 ASL9, LBD3 LOB DOMAIN-CONTAINING PROTEIN 3, ASYMMETRIC LEAVES 2-like 9 (.1) AT3G27650 135 / 5e-41 AS2 LBD25 LOB domain-containing protein 25 (.1) AT2G23660 140 / 8e-41 AS2 LBD10 LOB domain-containing protein 10 (.1.2) AT2G30340 138 / 9e-41 AS2 LBD13 LOB domain-containing protein 13 (.1) AT2G40470 136 / 2e-40 AS2 ASL11, LBD15 ASYMMETRIC LEAVES2-LIKE 11, LOB domain-containing protein 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017431 [exp] 272 / 1e-94 AT2G30130 199 / 1e-65 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10031855 [exp] 184 / 1e-59 AT2G30130 220 / 4e-74 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10031285 [exp] 183 / 2e-59 AT2G30130 226 / 3e-76 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10040638 [exp] 162 / 4e-51 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1) Lus10018275 [exp] 161 / 1e-50 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10031769 [exp] 150 / 1e-46 AT1G31320 193 / 8e-64 LOB domain-containing protein 4 (.1) Lus10031191 [exp] 149 / 2e-46 AT1G31320 199 / 2e-66 LOB domain-containing protein 4 (.1) Lus10009930 [exp] 144 / 1e-43 AT2G30340 230 / 5e-76 LOB domain-containing protein 13 (.1) Lus10040373 [exp] 142 / 2e-42 AT2G28500 211 / 7e-69 LOB domain-containing protein 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G281600 [exp] 184 / 8e-60 AT2G30130 248 / 4e-85 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.008G072800 [exp] 182 / 4e-59 AT2G30130 229 / 8e-78 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.010G184400 [exp] 181 / 8e-59 AT2G30130 227 / 7e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.009G076900 [exp] 177 / 4e-57 AT2G30130 228 / 2e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.005G097800 [exp] 157 / 1e-49 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.007G066700 [exp] 156 / 3e-49 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.003G149000 [exp] 155 / 1e-48 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1) Potri.001G081400 [exp] 155 / 2e-48 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1) Potri.008G043900 [exp] 144 / 2e-43 AT1G07900 218 / 2e-72 LOB domain-containing protein 1 (.1) Potri.013G081200 [exp] 143 / 3e-43 AT2G40470 249 / 2e-84 ASYMMETRIC LEAVES2-LIKE 11, LOB domain-containing protein 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10007525 pacid=23176482 polypeptide=Lus10007525 locus=Lus10007525.g ID=Lus10007525.BGIv1.0 annot-version=v1.0 ATGGTCGCCGGAGCTTCTACTTCACCGTGCGCTTCTTGCAAGCTCCTCCGGCGACGGTGCGCCAAGGACTGCATCTTCGCACCCTACTTCCCTTCCCACG ACCCCCACAAGTTCGCCATCGTCCATAAGGTCTTCGGCGCCAGCAACGTCAGCAAAATGCTACAGGATCTTCCGGTGGAGAGGAGGGCGGACGCGGTGAG CAGCCTGGTGTACGAAGCGGGAGCTCGGGTGCGGGACCCGATCTACGGGTGCGTAGGAGCCATATCGTACCTTCAGAGGCAAGTGTCGCAGCTCCAAATG CAGCTTGCTCTGGCTCAAGCGGAGATCCTCTGCATCGCGGGGCAGCAGTTCAAGGCTGCAGCAGCAGCTCCTAATTATAATCTGGCCATGATTAGTGACG ATGATAATTACACGACAAATTCAGAGTCTTCGCTGGACGACGTCGTATTGGACAACAATAAGTCGTTGTTTCTCTTGCAACATGGCTTGCAAGTGGGTCA AAATCACCACCATGATGATCACCGTCAATATATTGATTTTTGA
AA sequence Show only first row Show all	>Lus10007525 pacid=23176482 polypeptide=Lus10007525 locus=Lus10007525.g ID=Lus10007525.BGIv1.0 annot-version=v1.0 MVAGASTSPCASCKLLRRRCAKDCIFAPYFPSHDPHKFAIVHKVFGASNVSKMLQDLPVERRADAVSSLVYEAGARVRDPIYGCVGAISYLQRQVSQLQM QLALAQAEILCIAGQQFKAAAAAPNYNLAMISDDDNYTTNSESSLDDVVLDNNKSLFLLQHGLQVGQNHHHDDHRQYIDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10007525 [exp]	0	1
					Lus10012740 [exp]	2.2	0.8549
AT5G56040			Leucine-rich receptor-like pro...		Lus10042090 [exp]	4.6	0.8057
AT1G24530			Transducin/WD40 repeat-like su...		Lus10006233 [exp]	6.5	0.7816
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10021718 [exp]	6.7	0.7748
AT2G24580			FAD-dependent oxidoreductase f...		Lus10020132 [exp]	7.3	0.8198
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10027573 [exp]	8.1	0.8017
AT4G37650	GRAS	SGR7, SHR	SHORT ROOT, SHOOT GRAVITROPISM...		Lus10012089 [exp]	10.2	0.7798
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10002355 [exp]	12.1	0.7510
AT4G12040		AtSAP7	stress-associated protein 7, A...		Lus10030150 [exp]	19.0	0.7519
AT2G47550			Plant invertase/pectin methyle...		Lus10020680 [exp]	24.9	0.8030

Compare expression of checked genes

Lus10007525 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.