Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38310 194 / 5e-64 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 192 / 4e-63 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G05440 183 / 1e-59 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G01360 167 / 9e-54 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT5G53160 163 / 5e-52 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT4G01026 163 / 7e-52 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT2G26040 162 / 7e-52 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT4G17870 160 / 4e-51 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G27920 147 / 1e-45 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT1G73000 145 / 8e-45 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012231 [exp] 224 / 2e-75 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10014239 [exp] 211 / 1e-70 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 213 / 2e-70 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10002861 [exp] 190 / 2e-62 AT2G38310 176 / 7e-56 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 164 / 3e-52 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10001059 [exp] 162 / 2e-51 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10029222 [exp] 161 / 5e-51 AT2G40330 182 / 2e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10026430 [exp] 161 / 6e-51 AT2G26040 264 / 1e-90 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10039335 [exp] 161 / 6e-51 AT5G53160 295 / 4e-103 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G104100 [exp] 218 / 5e-73 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.016G125400 [exp] 217 / 6e-73 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 202 / 3e-67 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.008G073400 [exp] 197 / 4e-65 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G230600 [exp] 174 / 2e-56 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.018G054400 [exp] 173 / 7e-56 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.001G142500 [exp] 172 / 2e-55 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.003G091700 [exp] 165 / 1e-52 AT4G17870 273 / 3e-94 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.003G139200 [exp] 162 / 2e-51 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.002G169400 [exp] 161 / 3e-51 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10007530 pacid=23176516 polypeptide=Lus10007530 locus=Lus10007530.g ID=Lus10007530.BGIv1.0 annot-version=v1.0 ATGGTGCGGCGGTTCGACAACCCGCAGGCGTACAAGCACTTCCTCAAGAGCTGCCAGGTGATCGACGGCGACGGGGACGTGGGCACCCTCCGCGAGGTCC GCGTGGTGTCGGGGCTCCCCGCGGCCTCGAGCACCGAGCGGCTCGAGATCCTGGACGACGAGCGCCACGTCATCAGCTTCAGCGTTGTGGGAGGGGACCA CCGCCTCCACAACTACCGCTCCGTGACCACCCTCCACCCTGCCGCCGCCGGAGGAGGCGGAGGGACGGTGGTGGTGGAGTCTTACGTGGTGGATATACCG GCGGGGAATACAAAAGAGGACACGTGTAGCTTTGTGGATACAATCGTACGGTGCAACTTGCAGTCGTTGGCTCAGATCGCTGAGAACATGGCCAGAGCAA ATGATCATCAACGGCAAATTATAAATTAA
AA sequence Show only first row Show all	>Lus10007530 pacid=23176516 polypeptide=Lus10007530 locus=Lus10007530.g ID=Lus10007530.BGIv1.0 annot-version=v1.0 MVRRFDNPQAYKHFLKSCQVIDGDGDVGTLREVRVVSGLPAASSTERLEILDDERHVISFSVVGGDHRLHNYRSVTTLHPAAAGGGGGTVVVESYVVDIP AGNTKEDTCSFVDTIVRCNLQSLAQIAENMARANDHQRQIIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10007530 [exp]	0	1
AT4G08320		TPR8	tetratricopeptide repeat 8, Te...		Lus10025656 [exp]	6.9	0.9473
AT3G51660			Tautomerase/MIF superfamily pr...		Lus10000344 [exp]	9.0	0.9412
AT1G15170			MATE efflux family protein (.1...		Lus10028540 [exp]	10.0	0.9494
					Lus10032742 [exp]	13.4	0.9451
AT4G25030			unknown protein		Lus10036514 [exp]	14.8	0.9405
					Lus10011653 [exp]	16.9	0.9449
AT5G50120			Transducin/WD40 repeat-like su...		Lus10034117 [exp]	22.0	0.8977
AT1G23550		SRO2	similar to RCD one 2 (.1)		Lus10030878 [exp]	22.6	0.8958
AT5G53850			haloacid dehalogenase-like hyd...		Lus10009198 [exp]	23.1	0.9396
AT5G36930			Disease resistance protein (TI...		Lus10037406 [exp]	24.0	0.8923

Compare expression of checked genes

Lus10007530 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.