Lus10007536 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39670 124 / 1e-35 Calcium-binding EF-hand family protein (.1)
AT3G29000 114 / 5e-32 Calcium-binding EF-hand family protein (.1)
AT3G47480 76 / 5e-17 Calcium-binding EF-hand family protein (.1)
AT2G43290 72 / 2e-15 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
AT3G59440 71 / 4e-15 Calcium-binding EF-hand family protein (.1)
AT4G12860 68 / 2e-14 UNE14 unfertilized embryo sac 14, EF hand calcium-binding protein family (.1)
AT1G05990 67 / 3e-14 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1)
AT4G03290 67 / 3e-14 EF hand calcium-binding protein family (.1)
AT3G07490 64 / 7e-13 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1)
AT4G20780 63 / 2e-12 CML42 calmodulin like 42 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012199 325 / 7e-115 AT5G39670 131 / 3e-38 Calcium-binding EF-hand family protein (.1)
Lus10026301 209 / 4e-69 AT5G39670 135 / 5e-40 Calcium-binding EF-hand family protein (.1)
Lus10042369 207 / 4e-68 AT5G39670 133 / 2e-39 Calcium-binding EF-hand family protein (.1)
Lus10019090 99 / 1e-25 AT3G29000 103 / 1e-27 Calcium-binding EF-hand family protein (.1)
Lus10034463 97 / 4e-25 AT3G29000 103 / 2e-27 Calcium-binding EF-hand family protein (.1)
Lus10027701 76 / 1e-16 AT2G43290 153 / 2e-46 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
Lus10020389 69 / 1e-15 AT3G07490 130 / 1e-40 calmodulin-like 3, ARF-GAP domain 11 (.1)
Lus10038088 69 / 6e-14 AT3G07490 150 / 7e-46 calmodulin-like 3, ARF-GAP domain 11 (.1)
Lus10006644 69 / 6e-14 AT3G07490 148 / 3e-45 calmodulin-like 3, ARF-GAP domain 11 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G084800 161 / 4e-50 AT5G39670 142 / 1e-42 Calcium-binding EF-hand family protein (.1)
Potri.004G122900 134 / 2e-39 AT5G39670 141 / 3e-42 Calcium-binding EF-hand family protein (.1)
Potri.017G029700 76 / 7e-17 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.008G087900 72 / 6e-16 AT3G29000 62 / 2e-12 Calcium-binding EF-hand family protein (.1)
Potri.007G128600 73 / 7e-16 AT2G43290 218 / 3e-72 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
Potri.002G239100 68 / 2e-14 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.018G127100 67 / 1e-13 AT3G07490 132 / 6e-39 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.006G065900 66 / 3e-13 AT3G07490 131 / 1e-38 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.002G047300 62 / 6e-12 AT3G22930 171 / 3e-54 calmodulin-like 11 (.1)
Potri.006G276500 61 / 9e-12 AT4G20780 74 / 8e-17 calmodulin like 42 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0220 EF_hand PF00036 EF-hand_1 EF hand
Representative CDS sequence
>Lus10007536 pacid=23148094 polypeptide=Lus10007536 locus=Lus10007536.g ID=Lus10007536.BGIv1.0 annot-version=v1.0
ATGGCTTTCTTCCAATTCTACTACTTGATCACACCCCTAGAACCAATCTTCACTAACAAGCAATCTTCCTCTACTTCTTCATTCATAGCTCTATTCCTTG
ACATCATCTTGTGCAAACTAATCCTGGACCGGATCGGATACCCCCACAACAAACTCTTCTCCAGATTCTGGTTCTTTTTCAAGCAACAGTTGAGAGTTGC
TGTAAAAGTAACAGAAGAAGTAGTACCAGTACCAGTACTATTTAAGGCTGCAGAGTTGGAGGGAGAGATATTAAGCAGAGAAGATGTGGAGACTGCGATG
TCGAAGCTTGGATTCGTGAGCAACCCGGAAGGGGAACAGCTTAGGGAGAAAATGGGTAGTGATCAGATATTGGAGCTTTTCGACGAGAGGGAGCCTAGCT
TGGAGGAAGTGAAAGAGGCATTTGAGGTGTTCGACTTGAACGGAGATGGGTTCGTGGATGAGTTGGAGCTGCAGAGGGTTATGGTTGCCTTGGGGTTCAA
GGAAGGGTTTGGACTTGAGAGGTGTAGGGAGATGATCAGAGTGGTTGATGAGAATGGTGATGGGATGGTTGAGTTTGGGGAGTTTGTTAAGCTTATGGAG
AATAGTTTTTGTTAA
AA sequence
>Lus10007536 pacid=23148094 polypeptide=Lus10007536 locus=Lus10007536.g ID=Lus10007536.BGIv1.0 annot-version=v1.0
MAFFQFYYLITPLEPIFTNKQSSSTSSFIALFLDIILCKLILDRIGYPHNKLFSRFWFFFKQQLRVAVKVTEEVVPVPVLFKAAELEGEILSREDVETAM
SKLGFVSNPEGEQLREKMGSDQILELFDEREPSLEEVKEAFEVFDLNGDGFVDELELQRVMVALGFKEGFGLERCREMIRVVDENGDGMVEFGEFVKLME
NSFC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39670 Calcium-binding EF-hand family... Lus10007536 0 1
AT1G59710 Protein of unknown function (D... Lus10030804 1.0 0.9206
AT5G39670 Calcium-binding EF-hand family... Lus10042369 3.5 0.9062
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10020772 6.0 0.8874
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10007349 7.5 0.8779
AT2G46330 ATAGP16, AGP16 arabinogalactan protein 16 (.1... Lus10024263 7.9 0.9007
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Lus10028463 9.2 0.8481
Lus10029449 11.2 0.8597
AT2G23810 TET8 tetraspanin8 (.1) Lus10008891 11.2 0.8731
AT2G23140 RING/U-box superfamily protein... Lus10011516 12.6 0.8444
AT5G48290 Heavy metal transport/detoxifi... Lus10025181 13.4 0.8815

Lus10007536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.