Lus10007541 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18100 228 / 2e-78 Ribosomal protein L32e (.1)
AT5G46430 224 / 3e-77 Ribosomal protein L32e (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012195 247 / 6e-86 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10011970 245 / 3e-85 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10004589 244 / 7e-85 AT4G18100 247 / 4e-86 Ribosomal protein L32e (.1)
Lus10020410 243 / 2e-84 AT4G18100 242 / 3e-84 Ribosomal protein L32e (.1)
Lus10031699 242 / 4e-84 AT4G18100 240 / 2e-83 Ribosomal protein L32e (.1)
Lus10009591 243 / 4e-83 AT4G18100 243 / 4e-83 Ribosomal protein L32e (.1)
Lus10031120 243 / 1e-80 AT3G22660 289 / 9e-96 rRNA processing protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G353900 234 / 7e-81 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.014G191000 234 / 7e-81 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.002G249000 231 / 1e-79 AT4G18100 226 / 5e-78 Ribosomal protein L32e (.1)
Potri.011G078200 229 / 7e-79 AT4G18100 225 / 2e-77 Ribosomal protein L32e (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01655 Ribosomal_L32e Ribosomal protein L32
Representative CDS sequence
>Lus10007541 pacid=23148116 polypeptide=Lus10007541 locus=Lus10007541.g ID=Lus10007541.BGIv1.0 annot-version=v1.0
ATGGCGGTTCCTCTACTGACCAAGAAGATTGTGAAGAAGAGAGTCAAGCAGTTTAAGAGGCCTCAGAGTGATCGTAAGATATGTGTCAAGGAGAACTGGA
GGAGGCCAAAGGGTATTGACTCGAGGGTGAGGAGGAAGTTCAAAGGAGTTACTTTGATGCCCAACATTGGTTACGGGTCCGACAAGAAAACCCGACATTA
TCTCCCCAATGGGTTCAAGAAGTTTGTCGTCCACAACGTCAAGGAGCTTGAGGTCTTGATGATGCACAACAGGACTTACTGTGCGGAGATTGCGCACGAT
GTCTCGACCCGCAAGAGAAAGGATATCGTTGAGCGTGCAGCTCAGCTTGATATTGTTGTAACGAACAAGCTCGCCAGGTTGCGTAGCCAGGAAGATGAAT
AG
AA sequence
>Lus10007541 pacid=23148116 polypeptide=Lus10007541 locus=Lus10007541.g ID=Lus10007541.BGIv1.0 annot-version=v1.0
MAVPLLTKKIVKKRVKQFKRPQSDRKICVKENWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLMMHNRTYCAEIAHD
VSTRKRKDIVERAAQLDIVVTNKLARLRSQEDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18100 Ribosomal protein L32e (.1) Lus10007541 0 1
AT2G47640 Small nuclear ribonucleoprotei... Lus10030367 4.1 0.8505
AT3G10050 OMR1 L-O-methylthreonine resistant ... Lus10014390 5.3 0.8491
AT1G04590 EMB2748 unknown protein Lus10015943 7.5 0.8199
AT4G21090 ATMFDX2 ARABIDOPSIS MITOCHONDRIAL FER... Lus10014947 7.9 0.8481
AT1G67590 Remorin family protein (.1.2) Lus10015817 8.9 0.8349
AT3G54560 HTA11 histone H2A 11 (.1) Lus10003088 11.4 0.8107
AT1G67590 Remorin family protein (.1.2) Lus10036996 14.3 0.8058
AT2G28070 ABCG3 ATP-binding cassette G3, ABC-2... Lus10041334 14.7 0.7812
AT1G08640 CJD1 Chloroplast J-like domain 1 (.... Lus10022022 17.5 0.8200
AT3G02860 C2H2ZnF zinc ion binding (.1.2) Lus10037693 20.0 0.7995

Lus10007541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.