Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00860 129 / 4e-41 AT0ZI1, ATOZI1 Arabidopsis thaliana ozone-induced protein 1, Protein of unknown function (DUF1138) (.1) AT1G01170 124 / 4e-39 Protein of unknown function (DUF1138) (.1), Protein of unknown function (DUF1138) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012194 [exp] 146 / 2e-47 AT4G00860 115 / 3e-35 Arabidopsis thaliana ozone-induced protein 1, Protein of unknown function (DUF1138) (.1) Lus10042373 [exp] 135 / 1e-43 AT1G01170 119 / 5e-37 Protein of unknown function (DUF1138) (.1), Protein of unknown function (DUF1138) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G051900 [exp] 134 / 6e-43 AT1G01170 125 / 2e-39 Protein of unknown function (DUF1138) (.1), Protein of unknown function (DUF1138) (.2) Potri.016G055200 [exp] 129 / 4e-41 AT1G01170 120 / 2e-37 Protein of unknown function (DUF1138) (.1), Protein of unknown function (DUF1138) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06592 [flax] [poplar] DUF1138 Protein of unknown function (DUF1138)
Representative CDS sequence Show only first row Show all	>Lus10007542 pacid=23148117 polypeptide=Lus10007542 locus=Lus10007542.g ID=Lus10007542.BGIv1.0 annot-version=v1.0 ATGTCAGGCAAGTACATCATGGGTGCTCTAGCTGGATCATTTGTGGTCGCCTACGTGTGCGACAGGATTATATCCGACGCGAAGATTTTCGGCGGATCCA CACCAGGCACAGTCTCGAACAAGCAATGGGGGGAGGAGACCGACAAGAGGTTCCAGGCATGGCCACGCACTGCCGGTCCACCAGTCGTGATGAACCCCAT CAGCCGCCAGAACTTCATCGTCAAGTCCCGAGATTGA
AA sequence Show only first row Show all	>Lus10007542 pacid=23148117 polypeptide=Lus10007542 locus=Lus10007542.g ID=Lus10007542.BGIv1.0 annot-version=v1.0 MSGKYIMGALAGSFVVAYVCDRIISDAKIFGGSTPGTVSNKQWGEETDKRFQAWPRTAGPPVVMNPISRQNFIVKSRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00860		AT0ZI1, ATOZI1	Arabidopsis thaliana ozone-ind...		Lus10007542 [exp]	0	1
AT5G41670			6-phosphogluconate dehydrogena...		Lus10024725 [exp]	1.0	0.9557
AT4G13870		WRNEXO, ATWRNEX...	Werner syndrome-like exonuclea...		Lus10039164 [exp]	2.0	0.9497
AT3G26340			N-terminal nucleophile aminohy...		Lus10006426 [exp]	2.8	0.9444
AT4G37830			cytochrome c oxidase-related (...		Lus10019250 [exp]	4.2	0.9450
AT4G30010			unknown protein		Lus10001443 [exp]	4.2	0.9273
AT2G25670			unknown protein		Lus10017738 [exp]	5.5	0.9422
AT3G48730		GSA2	glutamate-1-semialdehyde 2,1-a...		Lus10030551 [exp]	6.0	0.9403
AT1G08830		CSD1	copper/zinc superoxide dismuta...		Lus10004139 [exp]	7.0	0.9317
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10039296 [exp]	7.3	0.9174
AT3G43520			Transmembrane proteins 14C (.1...		Lus10027640 [exp]	8.4	0.9247

Compare expression of checked genes

Lus10007542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.