Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42905 44 / 1e-06 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007199 [exp] 46 / 5e-08 AT5G42905 45 / 9e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007550 pacid=23148073 polypeptide=Lus10007550 locus=Lus10007550.g ID=Lus10007550.BGIv1.0 annot-version=v1.0 ATGATAGGATGGCAGAAACCAAATGATAGCTGGGTGAAAATCAACGTGGACGGAAGAAGTCGAAACGAGCCGCATTCCGCTGCATACGGAGGGGTGATCC GGGAGAGGACAGGCCCTACTTGCCTTTCCGCCGCCGGAGGCGGTGAGCATATGGAGAGCAGACATGGAAGGCAAATGCTATCCACGAAGATAACTTTCTT CTCTACATTTTATGTTCATTGA
AA sequence Show only first row Show all	>Lus10007550 pacid=23148073 polypeptide=Lus10007550 locus=Lus10007550.g ID=Lus10007550.BGIv1.0 annot-version=v1.0 MIGWQKPNDSWVKINVDGRSRNEPHSAAYGGVIRERTGPTCLSAAGGGEHMESRHGRQMLSTKITFFSTFYVH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42905			Polynucleotidyl transferase, r...		Lus10007550 [exp]	0	1
AT4G16640			Matrixin family protein (.1)		Lus10037419 [exp]	3.3	0.9421
AT1G43650			nodulin MtN21 /EamA-like trans...		Lus10018890 [exp]	5.1	0.6739
AT1G79800		AtENODL7	early nodulin-like protein 7 (...		Lus10024846 [exp]	5.7	0.7763
					Lus10035508 [exp]	5.7	0.8603
AT5G25530			DNAJ heat shock family protein...		Lus10041254 [exp]	6.6	0.7135
AT5G52605			Defensin-like (DEFL) family pr...		Lus10031095 [exp]	6.9	0.8603
AT1G21000			PLATZ transcription factor fam...		Lus10005350 [exp]	8.0	0.8603
					Lus10012045 [exp]	8.2	0.7598
AT3G18040		ATMPK9	MAP kinase 9 (.1.2)		Lus10038956 [exp]	8.9	0.8603
AT5G56670			Ribosomal protein S30 family p...		Lus10019054 [exp]	9.8	0.8603

Compare expression of checked genes

Lus10007550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.