Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75590 47 / 2e-07 SAUR-like auxin-responsive protein family (.1) AT1G19840 45 / 6e-07 SAUR-like auxin-responsive protein family (.1) AT5G10990 43 / 7e-06 SAUR-like auxin-responsive protein family (.1) AT4G34750 40 / 7e-05 SAUR-like auxin-responsive protein family (.1.2) AT2G24400 39 / 0.0003 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042374 [exp] 87 / 5e-23 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 80 / 6e-20 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 49 / 5e-08 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 49 / 6e-08 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2) Lus10012426 [exp] 47 / 3e-07 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 45 / 8e-07 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10024322 [exp] 40 / 7e-05 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G125900 [exp] 57 / 2e-11 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 57 / 2e-11 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.005G237000 [exp] 47 / 2e-07 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 46 / 3e-07 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10007552 pacid=23148065 polypeptide=Lus10007552 locus=Lus10007552.g ID=Lus10007552.BGIv1.0 annot-version=v1.0 ATGTCGAAGTCCAACAAAATCCGCCACATCGTCAGAATCCACCAGATGCTCAAGCACTGGCGCCACAAAGCCAGAGCCAATAAGTCCACCTTCTCGTCCT CCTCCTCCCATTCATCATCATCATCATCATCACCCGAAGTCCCCGCCGGACACGTGGCGGTCCACGTCGGAGCGAGCGGCCAGAGATTCGTTGTCAGAGC CAGGTACCTCAACCAGAGACAAAGCGGTGATTGGCTGCGGCGGCGGCGGGGAAGCGAGGCCGTTGCTTCGTGGTTAGGGGTTTTTTTTAGAGTTAGTTTG TTAAGAGTTGTTCACTCTACTACTGACTGGTTTGACTCACTGAGTCGAGAATTGTGA
AA sequence Show only first row Show all	>Lus10007552 pacid=23148065 polypeptide=Lus10007552 locus=Lus10007552.g ID=Lus10007552.BGIv1.0 annot-version=v1.0 MSKSNKIRHIVRIHQMLKHWRHKARANKSTFSSSSSHSSSSSSSPEVPAGHVAVHVGASGQRFVVRARYLNQRQSGDWLRRRRGSEAVASWLGVFFRVSL LRVVHSTTDWFDSLSREL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75590			SAUR-like auxin-responsive pro...		Lus10007552 [exp]	0	1
AT5G56810			F-box/RNI-like/FBD-like domain...		Lus10007058 [exp]	5.5	0.7556
AT2G33835	C3HZnF	FES1	FRIGIDA-ESSENTIAL 1, Zinc fing...		Lus10015319 [exp]	5.5	0.8011
AT5G25510			Protein phosphatase 2A regulat...		Lus10013141 [exp]	6.5	0.8301
AT3G53900		UPP, PYRR	PYRIMIDINE R, uracil phosphori...		Lus10024350 [exp]	6.9	0.8274
AT5G39760	ZF_HD	ATHB23, ZHD10	ZINC FINGER HOMEODOMAIN 10, ho...		Lus10005244 [exp]	9.4	0.8103
AT5G25510			Protein phosphatase 2A regulat...		Lus10008104 [exp]	12.2	0.8193
AT3G51650			unknown protein		Lus10009097 [exp]	12.7	0.7890
AT2G22370			unknown protein		Lus10023150 [exp]	13.4	0.7849
AT1G12530			unknown protein		Lus10006705 [exp]	13.9	0.7641
AT4G34750			SAUR-like auxin-responsive pro...		Lus10012190 [exp]	14.4	0.7854

Compare expression of checked genes

Lus10007552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.